SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012788 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012788
Domain Number 1 Region: 411-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.14e-74
Family Protein kinases, catalytic subunit 0.000000364
Further Details:      
 
Domain Number 2 Region: 251-338
Classification Level Classification E-value
Superfamily Kringle-like 1.52e-34
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 8-98
Classification Level Classification E-value
Superfamily Immunoglobulin 5.34e-22
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012788
Domain Number - Region: 142-224
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00144
Family Frizzled cysteine-rich domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012788   Gene: ENSORLG00000010196   Transcript: ENSORLT00000012789
Sequence length 836
Comment pep:known_by_projection chromosome:MEDAKA1:4:16999296:17030728:-1 gene:ENSORLG00000010196 transcript:ENSORLT00000012789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIRIDAPMNNITTSLGQTAELLCRVSGNPQPEVRWLKNDAPVVQEPRRVSIRSMPYGSRL
RIRNLDTTDTGYFQCMASNSKGSVSTTGVLFVKFAPHNPNLTFEDDFDEDGFCQPYRGIA
CARFIGNRSIFVDSLQMQGEIETQITAAFTMIGTSNQLSDRCSQFAIPSLCHFAFPTCDR
SSGSDKPRDLCKDECEILENDLCKTEYIIARSNPHILKRLKLPNCEELAASDSPEAANCL
RIGIPMPEPINKNHKCYNSSGVDYRGTVSVTKSGRQCQPWNSQYPHSHTYLAVRYPELNG
GHSYCRNPGNKHEAPWCFTLDEGVRMELCDISICDHNEKASGNMEILYILVPSVAIPLAI
ALLFFFICVCRNNQMSARPPAPRQPKLVRGQNLEISVLNTAYKSKGKAKELPLSAVRFME
ELGECNFGKIYKGHLYLPGMDQAQLVAIKTLKDVSNTKQWADFQQESAVLAELQHPNVVC
LLGVVTQEHPVCMLFEFLPQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAI
QVSAGMEYLASHFYIHKDLAARNILVGEQLHVKISDLGLSREIYSSDYYCIQPKTLLPIR
WMPPEAIAYGKFTTDSDIWSFGVVLWEIFSYGLQPYYGFSNQEVMEMVRKRQLLPCPEDC
PPRFYGLMTECWQEGPARRPRFKDIHTRLRAWEGLSSHASSSTPSGGGGNATTQTTSLSA
SPVSNLSNPRYAAATAAGYLYPAQAIPAPGQMAPITAWTPMAVPQTHQRFIPVNGYPIPP
GYTAFPAHFAPQAPPTRVIQHHLPPPKSRSPSSASGSTSTGHVSGVHSTTGSAHEA
Download sequence
Identical sequences H2M2Z0
ENSORLP00000012788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]