SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012868 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012868
Domain Number 1 Region: 3-109
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000115
Family Recombinase DNA-binding domain 0.058
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012868
Domain Number - Region: 198-241
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 0.068
Family Transcription factor STAT-4 N-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012868   Gene: ENSORLG00000010266   Transcript: ENSORLT00000012869
Sequence length 316
Comment pep:novel chromosome:MEDAKA1:18:25222685:25226089:-1 gene:ENSORLG00000010266 transcript:ENSORLT00000012869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKELSKDLRNLIVAKHTEGIGYRRISFFLKVPVSTIGAIIRKWKEHSITINLPRPGAPR
QISDRGVRTIIRRVLQQPRTTRGELQKELESAGTVVSKKTMSNALDRHGLHARTPRKTPF
LKKKHVEARLDKPMKFWEKILWSDETKIELFGCXPQNTIPTVKFGGGSIMAWGCFSCGTG
RLHIIEGIMTGEKYRDILDQNLLSSARLLKMERGWIFQQDNDPKHTAKVTLNWLKKKKRK
LLEWPSQSPDLNPIENLWKELKIRVHRRDPRNLEDLKAVCVDEWAKITPEQCIPLDSPYR
RRLEAVITNKGFCSKR
Download sequence
Identical sequences H2M367
ENSORLP00000012868 8090.ENSORLP00000012868 ENSORLP00000012868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]