SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012895 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012895
Domain Number 1 Region: 312-435
Classification Level Classification E-value
Superfamily TIMP-like 2.35e-33
Family Netrin-like domain (NTR/C345C module) 0.00048
Further Details:      
 
Domain Number 2 Region: 6-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 126-239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-32
Family Spermadhesin, CUB domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012895   Gene: ENSORLG00000010290   Transcript: ENSORLT00000012896
Sequence length 435
Comment pep:known_by_projection chromosome:MEDAKA1:14:19667949:19673720:-1 gene:ENSORLG00000010290 transcript:ENSORLT00000012896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPIFLCGGDLVAESGFVGSEGFPSSYKANSRCTWRITVPEGKVVTLNFRLFDLEADSQCR
YDYLDVYSDHSAVGKKLGRFCGTFRPGNLISSSNAMMLEMVTDGETQSSGFVAFFKATQP
YESQICGGKMTKSQGEIKTPNWPDGKYPLGVSCSWLITVGPDEVIQVKFDKFVVEADTEC
RFDFVAFFNGKETDDSRLIGKFCGDQTPEPIVTSSNELLVQFVSDYSVPLDGFLASYTSL
PRGSQPPAVGSGARSVPPEPVVKPVATVKPPIPTTTAPLPPTKPPRRNNPRTRGENQRVT
PSRPNGNKPNPQNPVCPKICKRNGTVKTGFCSSEFVITGQVTSMAPGPRGTLVVNISLIK
AFKAGRLTITQAGETMAVKLVSRCKKCPLFRRGSNYIIMGQVDEEGRGTLEPGAFTAPYK
APHQKLLMNISKQPC
Download sequence
Identical sequences H2M393
8090.ENSORLP00000012895 ENSORLP00000012895 ENSORLP00000012895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]