SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012934 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012934
Domain Number 1 Region: 623-845
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-53
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 1307-1520,1589-1609
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000596
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 
Domain Number 3 Region: 840-945,1011-1043
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000134
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012934   Gene: ENSORLG00000010324   Transcript: ENSORLT00000012935
Sequence length 1637
Comment pep:known_by_projection chromosome:MEDAKA1:13:19957576:20041072:-1 gene:ENSORLG00000010324 transcript:ENSORLT00000012935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNKIQISTSNPDISSETITLLNFLKSDLSGLRVHRTSVGDRAAGVESSSAYKKDSGPPHK
AVMSSSHRPSLKDLTATLRRAKSFTYSDKPSIGARCYLKGGATRRSSSEEQLDLDGEAGE
EEVMQTPMQRRCAQEARQVIQDICQMCTRSDEEDDAFLKRASGSGDSEENMLYEGSVDER
SGHESSLTDEGIVTEPEMGPSDLLERSLPADLTASLSADASEGVHVNPAASQGSGGGGFE
APATPGAVRRRRKFSPSNESAAAVGNGESTVYRSLSDPMPQRRCSAAGDGNKNYSSVDSN
FLGSLSVKGAGGGPSEASDAAAVTEYNDGGLQDDSVRDYSGVIKNIVSEPGAMDNLVVDD
HSNGKAPKKKSFSDPSRRSDALLLSQNDPQLRGQAGGAQPISELEQSGQIPPSSSEPILS
EQRGDLWEPKVQPARVKVTRSQSESCPKSNNDDEEKFNFNLKLAEVLSPRLIRRPTRKRP
NRLFVPQEDPFEPLELGPDGQQVSPNELASSPPLTTNSKTALKHVRHTSEPATFIPISPA
PHLQPLKEAESITVGPPADPEVTSKPAGEEAPSLEDVTQKYILELNASERDTGAKKNNSC
RPLGEPIEQKCSCTEQRRARDEPEAGSTARCRSRSKGEDMRKHVMMTLLDTEQSYVESLR
SLVQGYMRPLKQPDSGTIVDPLLVDEMFYQIPEILEHHEHFLDQVSSCVSQWHDRQTIGH
ILVQSFSKEALADMYSAYIDNFLNARDAVRIAKEAKPAFHKFLEQNMRENKEKQALGDLM
IKPVQRIPRYELLVKDLLKHTPEDHPDHSYLMDAQRDIKRLAEKINKGRRSAEEAEREAR
VIQEIEAHIEGVEHILNPQRKFLRQEIVMEAKTVGGKKDRSLFLFSDLIICTTLKRKSGS
LRRSSMSLYTAASVIDTTSKYKFLWKLPLEEVEVVKSSTQATNKESIQKMISRLEEDLST
MGQISKLSETLSFPHLSLDEVIKDLMASVHKELSEKQSLAFSMTFLPTKLEFTTVSAEST
FVFEFSSPDALSSFEQAFEDAKKKLAMNKDQWDPEFLKAIPIMKTRSGMQFSCASPSHSC
PDSGCEVWVCNSDGYVGQVCLLNIKDEPTVEACIAVCSARIICIAAVPGLKGRCNNDIKT
FEHACVQAHRETEATYLMDRGSEPTPSSTAAGHSQQQQLHISISRSTLELAEQPTGPGAE
LVPFDSDDTDDEDSPSPSSTLQSQASHSTISSSFGNDEGPGSKDMATETTSSEEEQEFPV
AGSYSAPGMLGVGGGSRALTESPMDGRAMRRSSRGSFTRASLEDLLSIDPEAYQSSVWLG
TEDGCIHVYQSSDNIRNRKNSMKMQHAASILCILFFDNKVFVSLANGEVIVYQRDAGSFW
DPQSSQTLVLGTPRSPVTKMVPVGGKLWCGSQNKVLIINPTTLVQEHWFQVGTDSSRCVI
CMVAYGHGVWLALQGSAQVRLYHAQTWESLTEVDVAPAVHKMLAGADAIIRQHKAACLRI
TALLACKDLLWIGTSAGVVLTLAIPAVTSGTGAGTLKSSLVPMGSAHGHTGHVRFLTSIE
LPEGFDMNFPPTTTNSTVEGGLQRRDSAHRRTSAHIPPKTNHLVISGGDGYEDFRLTNSS
ETVGRDDSTNHLLLWRV
Download sequence
Identical sequences H2M3D2
ENSORLP00000012934 ENSORLP00000012934 8090.ENSORLP00000012934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]