SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012940 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012940
Domain Number 1 Region: 129-185
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000981
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 567-631
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000314
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 1225-1282
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 975-1016
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000379
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 710-763
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 299-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 7 Region: 634-705
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number 8 Region: 1107-1155
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 9 Region: 841-895
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000017
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 
Domain Number 10 Region: 1352-1416
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000641
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000012940
Domain Number - Region: 1159-1218
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00034
Family TSP-1 type 1 repeat 0.0069
Further Details:      
 
Domain Number - Region: 449-510
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000641
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number - Region: 1280-1330
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000641
Family TSP-1 type 1 repeat 0.0074
Further Details:      
 
Domain Number - Region: 362-445
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000863
Family TSP-1 type 1 repeat 0.0076
Further Details:      
 
Domain Number - Region: 57-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00772
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 770-840
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0275
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 906-970
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0575
Family TSP-1 type 1 repeat 0.015
Further Details:      
 
Domain Number - Region: 1029-1090
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0876
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012940   Gene: ENSORLG00000010327   Transcript: ENSORLT00000012941
Sequence length 1601
Comment pep:known_by_projection chromosome:MEDAKA1:11:20790073:20824121:-1 gene:ENSORLG00000010327 transcript:ENSORLT00000012941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPWGRCMGSECGPGGSQSRAVWCSHPDGWTTLHTNCDQAERPDNQQGCFRVCDWHKDLYG
WQLGAWNQCVPVVMRNGGGQRPAVCSRGEEGIQTREVGCVQKADGEPAEDAICEYFEPRP
RQEQACLIPCPRDCVVSEFTPWTLCSKTCGMGLRNRVRNVLAPPLFGGSACPNLTEFQTC
QVGPCEGEESLYSLRVGPWGPCSVPNSRQTRQTDKALKENKERLRERGKVKDPETRELMK
KRRNKNRQNRPGGKFWDLQVGYQTREVSCQHKSGNMEALSMCSQEMLPVTFQACVVPRDC
DVTEWSEWSACSKECYDPNTPGGGQRTRTRRVSQFPLSGGAECPELEESEPCSPQADTAP
TCTLNTWKTTEWTECRVDALLSQQDRRRGNQTGLCGGGIQTREVYCVQAGAEMPSNLRTK
CDTAALRPVDSELCQGIPPNTTQLCHINCPVECEVSPWSAWGPCTFENCQDQATKKGFKL
RKRRIINEPTGGMGNCPHLVEAIPCDDPSCFEWLVVKLEECVPDNDRECGPGTQIPQVQC
VNSEGLFVEKQLCRDAILPMPTICEVPCPKDCALSPWTQWSPCSHTCSGKNAEGKQTRVR
SILAYNAGEGGVQCPNASALQEVRSCNDHPCTVYHWQTGPWGQCIEDSSFPYTNVSVGVT
RTDDGSCAVGMQTRKVICVRVNVGQVPPKKCPESLRPDTVRPCLLPCRKDCIVSPYSEWS
PCPSTCPGGGNSKKKQVRKRIIIQVPANGGQDCPEVLVQERDCEARSVCPGYRWKTHKWR
RCRLVPWSIRQDSPGAQETCGPGLQFRAISCRKQDGGQADIEACLKSASPMPPLTQQCHL
PCQEDCQLSSWSKFSSCTANCVGVRTRKRSLMGKSKKRDQCKNNQMYPLSETQYCPCKKY
NAQPVGNWSDCILPDNSRMEGQLGMKVQGDVKECGQGYRYQAMACYDQDSRLVETSRCNS
HGYIEEACIIPCPSDCKLSEWSNWSRCSKSCGSGVKVRSKWLREKPYNGGRPCPKLDHVN
QAQVYEVVPCLSDCGQYVWVAEPWSVWKISNVDLRSNCGEGVQTRKIRIRCMLNTIDGPS
EQVEDYLCDPEEMPLGARNSQLPCPGDCVLSDWGSWSPCPLPCNENRTRERTAFPLRQPG
NNKTCPPTTATEPCKMNSNCFHYSYNITADWSTCQLSEKAVCGYGIKTRMLDCVRSDGKS
VDPSFCKKLGLDRKLQMNASCVVECPVNCQLSDWSAWSECTRSCGLAGKLWRRRTVVQAP
QGDGRPCPYQMEQWKPCPVQPCYSWRYSAWSVCRSEGARCGHGMRFRNVSCFVSDGSGQQ
DSGLVDDELCADVELLVDGDAQIILQEACIIPCPGDCYLTDWTVWSPCQLNCVNGDDLGF
GSVQVRSRAVVAQDPENLLQCPEQELEARPCTGGQCFEYKWRSGPWRGSSRQVWCERSDG
LNVTGGCLQSSKPMADRSCHPPCTKPRSFCTEAGVCGCEEGFTEVMTSDGLLDQCTVIPM
LEIPTTGDNRADVKTIRGFNPTQPAASAPGRAGRTWFLQPFGPDGKLKTWVYGVAAGVFV
LLVFIISMTYLACKKPKKPPRRQMNNRLKPLTLAYDGDADM
Download sequence
Identical sequences H2M3D8
ENSORLP00000012940 8090.ENSORLP00000012940 ENSORLP00000012940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]