SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013061 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013061
Domain Number 1 Region: 675-733
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000929
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 734-790
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000128
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 2-34
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 616-673
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000798
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013061   Gene: ENSORLG00000010424   Transcript: ENSORLT00000013062
Sequence length 804
Comment pep:known_by_projection chromosome:MEDAKA1:16:15941398:15972421:1 gene:ENSORLG00000010424 transcript:ENSORLT00000013062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGVWSLWGEWSECSQTCGVGVSLRSRLCLAPPPPQTRPFSPLNWAGYLPGGNGRPATSPV
SPYYQSRHPGQHPSYNSPSVSTRGHKTQEQREPEQTRRPSSIRPGQFGYGKVPFSLSLHR
TNRQARHTVNGTDETLGLNMENIVAEEEQMGGDEKLINTGRAEEEKGELEISEALGTKEE
PETTTDRPRPHSPFSHRPHFDWSSVTAPPPPVHSFSRSRSSPFASPLHRPSQEHRDRELH
QGFNPRAPPDGNVYPFQHSHASHLGVESSRHGASQGCDTLHYSPWSPLRALSGANHCRSI
WSGSVRTKFLHSCSSSSETLLKCSFLVCGGGALDSRAEQCAAFNTQEFMGRFYNWEPFTE
VGEDKQCELTCRPAGYRFYVRQAERVRDGTPCFNVSTNDVCIEGRCLTEGCDGVLGSSTV
IDKCGVCGGQDSSCRKVTGSFQNATVTLGYHKILDIPAGARLINITERRTSPNYLALRSG
TGASVVNGRWAVDPPGEYKAGGTTFTYIRPRVQSEGKEGRGESLRAPGPTTTQLQLYVIF
HKDNPGIDYEFYMPVEKKAEKEKLTEREREPPVEIPRERPRERDTARAPLRSKTPLRSNA
RIPPRTDLPPDTQLPFVWRRGGLTQCSASCGKGFQHRVIICVNRQTDEEVPERKCDSAAK
PVPEEEPCNTHSCPPFWEVSAWSECSVSCGPGMQQRQLQCRQSFGNRSTMVHPQRCANLT
PPPSTQACHLQLCSHWEVDSDWSTCSVDCGVGKRTRSVRCVSDQGGVVNDNECNSRVRPQ
GSEECNMGPCVTNWYFTDWSNTVS
Download sequence
Identical sequences H2M3Q3
ENSORLP00000013061 8090.ENSORLP00000013061 ENSORLP00000013061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]