SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013213 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013213
Domain Number 1 Region: 164-204
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000667
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013213   Gene: ENSORLG00000010540   Transcript: ENSORLT00000013214
Sequence length 400
Comment pep:known_by_projection chromosome:MEDAKA1:24:2966369:2971906:-1 gene:ENSORLG00000010540 transcript:ENSORLT00000013214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNQVQSLDPEPHGQQRRWSHPQHRSVSVLPQPQPEEDANPFVFDINNFPDLANADISLQN
PNIQVSIEVVDDPQMEVEMDLANDKDWLPPSSPSSTVDWIGGQKLFWPLFWSYTDSNEDT
SSRSEATGEEDGEEDYSIDYGSEEPLPSGVGGDWDAHCAEKDSDEWTPWSPCSVTCGHGE
KKRTKSCGYSCTLTEASQCDLDPCPGDVNAVVEPFPFEMENGTEPFGTDVDSCEKWLNCK
SDFLQRYLHQVMSELPSCPCSFPFEVAYTVVSVYDEIRGRPFRWRDASGPKERLDVYKPS
ARNCIRSALSSDSSTLAAQQCCYDDRGRLITRGKGAGTPNLISTEFSQELHFKVDMLPWI
LCKGDWSRFHAVRPPNNGLHCQENPHEDVFMNELEEAREY
Download sequence
Identical sequences H2M452
8090.ENSORLP00000013213 ENSORLP00000013213 ENSORLP00000013213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]