SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013276 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013276
Domain Number 1 Region: 264-322
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000491
Family ATI-like 0.072
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013276
Domain Number - Region: 648-683
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00392
Family BSTI 0.033
Further Details:      
 
Domain Number - Region: 312-366
Classification Level Classification E-value
Superfamily FnI-like domain 0.00596
Family Fibronectin type I module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013276   Gene: ENSORLG00000010593   Transcript: ENSORLT00000013277
Sequence length 683
Comment pep:known_by_projection chromosome:MEDAKA1:18:25726147:25798041:1 gene:ENSORLG00000010593 transcript:ENSORLT00000013277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCIASGDPHYTTFDKHRYDFMGNCSYLMSGICNATSLPFFEVHADNENRYNSPTISYLKA
VHVYVHMVKISILKGGVVQVQVNGTNVNLPLNPAPEVSVFQSGKHYTVSMTFGVTVRYDG
NHFMDIKVIKDYQDKLCGLCGDYNGNSKDDFQKPDGTMTNDANEFGHSWNTDPECNKQPN
ATIPGCEPGEQELYEGYCGILLDKNGPFAVCHGKVNPNNYFQDCLFDLCELEGAKPILCE
AIEAYVNECQDRGVDIGPWRNETFCPLKCPPNSHYEPCADPCQDTCSGKPSSCGGACSEG
CVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYVEDCKLKCRCDSPFVTCVASDCP
PMHECKLQDGELGCYPSSIQDCIVSGDPHYNTFDKKFYSFMGTCTYTLARTCRNDSNPWF
SVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKRTLVNGKRVAFPHNPSPLMSLSLSG
QYVILQTTFGLRVRWDGNHHAQISVPSSYHDQMCGLCGDYDGNAGNDFTKPDGTPAGNVN
DFGNSWQTEEDEDEWCSPGTTPDLDCDPELEAEVTKPDKCGKIEDLSGPFRECIGVVDPE
PFFQSCVYDMCQFNGELHVLCDQLQAYTDACQSAGATVHHWRAPDFCPLDCPANSSYSLC
VSSCPETCLGVVGSPGCEDVCVE
Download sequence
Identical sequences H2M4B2
ENSORLP00000013276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]