SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013290 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013290
Domain Number 1 Region: 1229-1289
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000018
Family ATI-like 0.081
Further Details:      
 
Domain Number 2 Region: 840-902
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000719
Family ATI-like 0.045
Further Details:      
 
Domain Number 3 Region: 1610-1670
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000981
Family ATI-like 0.03
Further Details:      
 
Domain Number 4 Region: 433-493
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000114
Family ATI-like 0.059
Further Details:      
 
Domain Number 5 Region: 46-104
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000155
Family ATI-like 0.072
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013290
Domain Number - Region: 94-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.00691
Family Fibronectin type I module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013290   Gene: ENSORLG00000010593   Transcript: ENSORLT00000013291
Sequence length 1728
Comment pep:known_by_projection chromosome:MEDAKA1:18:25793381:25807399:1 gene:ENSORLG00000010593 transcript:ENSORLT00000013291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYFQDCLFDLCELEGAKPILCEAIEAYVNECQDRGVDIGPWRNETFCPLKCPPNSHYEPC
ADPCQDTCSGKPSSCGGACSEGCVCDPGYVLSAGKCVKRESCGCKHTNGQYYEPGEEFYV
EDCKLKCRCDSPFVTCVASDCPPMHECKLQDGELGCYPSSSQDCIVSGDPHYNTFDKKYY
SFMGTCTYTLARTCRNDSGRYPWFSVEGKNEERGASGVSYLKKLYVTVNDITVTLMKSKR
TLVLQVNGKRVAFPHNPSPLMSLSLSGQYVILQTTFGLRVRWDGNHHAQISVPSSYHDQM
CGLCGDYDGNAGNDFTKPDGTPAGNVNDFGNSWQTEEDEDEWCSPGTTPDLDCDPELEAE
VTKPDKCGKIEDLSGPFRECIGVVDPEPFFQSCVYDMCQFNGELHVLCDQLQAYTDACQS
AGATVHHWRAPDFCPLDCPANSSYSLCVSSCPETCLGVVGSPGCEDVCVEGCECDPGFIL
SDDKCVSLKDCGCVDTSGTYHPVDDEWLLEGCEQSCECLSGGQIQCHNTSCNPVTEVCQL
QDGLYECSPLGMCACPVCTASSYQLMSACLSSENGICSVSGDPHYTTFDKRTHHYMGACS
YTLTKLCNSSSDLPHFTVDTQNEHRGSNTKVSYVRAVVINVYGMTVVFGKGRSVQVNGTV
VVPPVSSISGVKIYFSGKFVVLEASFGLRVRFDGNHHADVTLPSSYSGLLCGMCGNFNDN
PTDDNLKPDNTPAANSNELGDSWAVPDPRPDCTNGGGQEECDEKVEEEAQKPTSCGMITD
PNGIFKPCHAVVPPEPYFENCVYDMCATGGQTVALCQALESYADICAAAGVNIPWRNSTF
CPLKCPTGSHYTPCGPACPQPSCQEPESSGDSCDLPCVEGCVCNDGLILSGDKCVPLSEC
GCTDEDGQYRPVGDSWFTETDCSERCKCNGNHNISCEPWQCSPAQECKVVEGVLDCHSTG
KGVCHVAGDPHYYTFDGIMHTFMGTCTYTLVEVCNKTQVTDFRVVAKNEERGQPEASYVR
SVKVFLPHDTEVELQKGRRVLLNGRRVRTPLTIDTIGAKVITSGSYSLLDTNFGLQVKFD
GVHHLEITVPGEYFNKLCGMCGNYNHDSTDDNLKPDKQPAKDVIELGNSWKSEGDSDPGC
QPDNRPDVHPNCTAEEEEQFKAQCEQVILSSSFRPCHSVVSPDAFLGNCIYDMCEYNGMQ
ATLCDNVEAYAQACQSAGVTITWRNSTFCPLPCPPNSHYSDCTAPCPPTCSDLFPIFCHL
PPTACVEGCECNAGYVLSDGKCVSLDKCGCVGSDGEYHDVGDSWLTDKCQESCTCNLGGQ
ITCEDHSCDDNSVCGPDKFGDVNCQPTKFDRCTVSGDPHYRTFDGFTHHYQGPYTYVLTQ
DHNLQGSLKPLMVRGKNLRRGGNKRVSFLDEMYVNVYGVDVQVNGERVTPPLSPVRGLTI
TMNSKQMQLTTDFGLTVRFDGKSRGEVILPRTYSNSVRGLCGNYDGITRNEYMKPDGTVV
RDLNEFGDSWRVRRDTETDPDSGFETSDCSQSELDDYTSVTKCGALSDPEGPFSACHAAL
PPQIYQDDCVFDLCAEDGSEELRCASYEAYATICQEAGVKLGSWRQQLGCALPCPANSTY
TACMSPCPSSCADLAAPSECDATACVEGCQCAAGFVMSEGACVPYPECGCTFLDRYYPLN
ENFVTEDCSQSCVSTSIGAVCQPKTCQAGYVCTIYDFRRDCYRGVCLC
Download sequence
Identical sequences H2M4C6
ENSORLP00000013290 8090.ENSORLP00000013290 ENSORLP00000013290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]