SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013382 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013382
Domain Number 1 Region: 586-789
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-44
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 1.7e-32
Family Bcr-Abl oncoprotein oligomerization domain 0.0000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013382   Gene: ENSORLG00000010674   Transcript: ENSORLT00000013383
Sequence length 803
Comment pep:known_by_projection chromosome:MEDAKA1:12:15765584:15830683:-1 gene:ENSORLG00000010674 transcript:ENSORLT00000013383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPVGFIEAWKAQFPESEPPKMELRSVGGIEQELEKCKASIRRLEQEVNKERFRMIYLQ
TLLAKERKSYDKQRWGFRKTPLNEGLDPEATQGAESQQPHVQETGGVGGYASVGDRSRFQ
PLGDGRSKPRPPPARKSASHGDGLEAAFDIPPQAESSSCEHLDGLSPSKQRCGVTMSPRR
PTLPPPDKELPSDPKDKLGMGLGVAALRSNFERIKRANSHSAGDVTKGQEKHLPPPPPPP
PFYTNMEFHHERGLVRVNDRELSEKISSLGSQAMQIERKRSLHSLPGNLATVAGDLRPKP
VYRGRSTESTCGYDAEYEDGEPNQRHSGRANGGKPPPPWQPSEFQAYSSVYVGGVMMGEG
GSGDGRGSGAVTMRDHGGGDDHLLTWPRRSYSPGSFEDAGGGGGYTPDCSSNENLTSSEE
DFSSGQSSHISPSPTTAFRRPLREKSRSPSQNSQNSQHSFDSSSPPTPQSQKRHHRQHGG
HVVMSEATIVSVRKTGQIWPPAAHHDLMSHGRTSHDNSFHGDHLDGHYTSTPPPYGYDAD
RAEEQRRHHDILPFIDDSPSSSPHLSSKSRSSRDTLSSGSLESSKSTECDLEKGLEMRKW
VLSGILATEETYLSHLEALLLPMKPLKAAATTSQPVLTVAQIETIFFKVPELYEIHKDFY
DALLPRVQQWSHHQRVGDLFQKLAGQLGVYRAFLDNYELAVETAEKCCQANAQFSEISEN
LKVRSPKDCKETAKTSLEALLYKPVDRVTRSTLVLHDLLKHTPTSHPDHPLLLDALRISQ
NFLSSINEETTPRRQSMTVKKGE
Download sequence
Identical sequences H2M4L4
ENSORLP00000013382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]