SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013425 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013425
Domain Number 1 Region: 514-758
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.33e-52
Family Eukaryotic proteases 0.0018
Further Details:      
 
Domain Number 2 Region: 175-279
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000883
Further Details:      
 
Domain Number 3 Region: 283-385
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00025
Further Details:      
 
Domain Number 4 Region: 387-485
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00019
Further Details:      
 
Domain Number 5 Region: 65-168
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00051
Further Details:      
 
Domain Number 6 Region: 1-67
Classification Level Classification E-value
Superfamily Kringle-like 6.52e-17
Family Kringle modules 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013425   Gene: ENSORLG00000010709   Transcript: ENSORLT00000013426
Sequence length 759
Comment pep:known_by_projection chromosome:MEDAKA1:19:12124094:12131465:-1 gene:ENSORLG00000010709 transcript:ENSORLT00000013426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQTDSGAPCLKWTEFPDYVMQYPGRGLGDHSYCRNPDRESNPWCFFRQSSGAIGWAYCD
CHQGAARLVGSSISGSGRVEIYLNGQWGAVCNSHWTDRDASVICRQLGFGDIGTALQHSQ
FGSGSGLFHYERLGCRGDEGTLMKCQSRTFVTGDCSHGNEATLVCAPPEGRSGPPLRLVE
GEEDFEGRVEVFHAGRWGTVCDDQWDDRDAEVVCRQLGFGGIAKAWSWAHFGQGSGPILL
DAVKCTGNELFLDQCSHGDWEQHNCDHMEDAGVSCSPYTDGVVRLVGGDSPWEGRVEVFH
NGDWGTVCDDHWSQQHAEVVCRQLGYRYQEKPVTHHHKSSAGLILLDDVHCEGSETSLLD
CRHGIWGRTDCSHSEDVGVRCRPGPLVRLVGGSSRKEGRVEVYLHGDWGSICDSGWNDLN
AAVVCRQLGHSGRATAAVGFGQGKGPIHLDQVRCTGKEEFLGECPSLGQSIQGCGRREDA
GVKCDATPHEAAVKTKPEELSCGLRKMVEVEGKKRNHEEESMSRTTWPWQVSVWLQSQKE
GEGPLCSGTLISPCWVLTSAFCLSRFGSDPTIYVVRVGASEQTLTPERLVLHRKFKGQSG
GHDLALLKLPSTKGHCLTFDPNTNAACLPGTDGAKEGNIPASCVVMVTTGWAGPGKIMIY
SVVASWVPLMSPWQCKKRFGNSFSSHGTLCAASPPDTSLLRGDGCQGNSGGGLVCQDESG
RWVLTGVVSGGYGCADPSSPALYTRVSRFRSWMDEVINP
Download sequence
Identical sequences H2M4Q6
ENSORLP00000013425 8090.ENSORLP00000013425 ENSORLP00000013425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]