SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013449 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013449
Domain Number 1 Region: 967-1180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-101
Family Thrombospondin C-terminal domain 0.0000000061
Further Details:      
 
Domain Number 2 Region: 33-234
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.43e-37
Family Laminin G-like module 0.0000211
Further Details:      
 
Domain Number 3 Region: 844-965
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.7e-37
Family TSP type-3 repeat 0.000000469
Further Details:      
 
Domain Number 4 Region: 500-558
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000118
Family TSP-1 type 1 repeat 0.0000794
Further Details:      
 
Domain Number 5 Region: 446-501
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000719
Family TSP-1 type 1 repeat 0.00014
Further Details:      
 
Domain Number 6 Region: 775-846
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000955
Family TSP type-3 repeat 0.00027
Further Details:      
 
Domain Number 7 Region: 326-384
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family VWC domain 0.0023
Further Details:      
 
Domain Number 8 Region: 704-787
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000144
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 9 Region: 392-435
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013449
Domain Number - Region: 559-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000285
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013449   Gene: ENSORLG00000010727   Transcript: ENSORLT00000013450
Sequence length 1182
Comment pep:known_by_projection chromosome:MEDAKA1:15:24752764:24766984:-1 gene:ENSORLG00000010727 transcript:ENSORLT00000013450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCEGEMKLWRHLFLFLSVFHQAASQDEEQLDETSFDLFEISHITRKTLGAKQFRGQNLDA
PAYRFIRFDFLPPVDPPILKQILEQIQNNEGFVFVASMRQDHTSRGTLVALEGPGGRRQF
EIISNGPANTLDLVYWVDGSQNVVSFEDVDLSDSQWKNITLHIHGENANLFVGCNLLDSF
VLDEPFYEHLRAEGSRMYVAKGSNRENHFRGLLQSVRFIFDTPVESILQNRGCEVIKQDD
PNTVRESTEVIDVRPSITTNIIGQKTDDLGSDMCERSCEELSTMFHELKGLRVVVSNLID
GLQKVTEENTVMKEALGRMKETKEKNMCWQDGRLFEDKEDWVVDSCTKCTCQESKIVCHQ
ITCPPVACASPSFVDGECCPVCMPSNTKDSEDGWSPWSEWTECTVTCGIGTQQRGRSCDA
TSNPCSGPSIQTRKCSLGKCDSRVRQDGGWSLWSPWSSCSVTCGEGQITRIRHCNAPVPQ
LGGTDCEGSGRETQNCTATPCPIDGGWGPWSPWASCSATCGGGIKSRTRECNSPQPQHGG
KKCLGEASDSDSCNKKDCPIDGCLSNPCFGGVDCSSSPDGSWECGPCPAGFRGNGTHCED
INECDMVSDVCYKVSGTQRCVNTNPGFHCLPCPKRYKGTQPFGMGVESAKRNKQVCEPEN
PCKDKTHSCHKFAECIYISHFSDPMYKCECRTGYAGDGFICGEDSDLDGWPNQNLVCGAN
TTYNCQKDNCPDLPNSGQEDFDRDGQGDACDKDDDNDGILDERDNCALLYNPRQFDFDKD
EVGDRCDNCPYEHNPAQIDTDHNGEGDACAVDIDGDDIHNDNDNCPYVYNTDQKDTDMDG
VGDQCDNCPLLHNPDQSDIDNDLVGDQCDNNQDIDEDGHQNNLDNCPYVANANQADHDKD
GKGDACDYDDDNDGVPDDKDNCRLTPNADQVDSDGDGRGDACKDDFDNDSIPDILDVCPE
NNAISVTDFRKFQMVHLDPKGTTQIDPNWVVRHQGKELVQTANSDPGIAVGFDEFNAVDF
SGTMYVNTDRDDDYAGFVFGYQSSGRFYVVMWKQITQTYWEYKPSKAFGISGVSLKVVNS
TTGTGENLRNALWHTGNTQGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGFIRVVVYEG
KQIMADSGPIYDKTFAGGRLGLFVFSQELVFFSDLKYECRGE
Download sequence
Identical sequences H2M4S8
ENSORLP00000013449 8090.ENSORLP00000013449 ENSORLP00000013449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]