SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013451 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013451
Domain Number 1 Region: 877-1090
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-101
Family Thrombospondin C-terminal domain 0.0000000061
Further Details:      
 
Domain Number 2 Region: 7-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.22e-37
Family Laminin G-like module 0.0000211
Further Details:      
 
Domain Number 3 Region: 754-875
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.57e-37
Family TSP type-3 repeat 0.000000469
Further Details:      
 
Domain Number 4 Region: 413-464
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000144
Family TSP-1 type 1 repeat 0.00016
Further Details:      
 
Domain Number 5 Region: 685-756
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000915
Family TSP type-3 repeat 0.00027
Further Details:      
 
Domain Number 6 Region: 298-356
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000045
Family VWC domain 0.0023
Further Details:      
 
Domain Number 7 Region: 614-697
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000123
Family TSP type-3 repeat 0.00015
Further Details:      
 
Domain Number 8 Region: 361-404
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000013451
Domain Number - Region: 469-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000285
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013451   Gene: ENSORLG00000010727   Transcript: ENSORLT00000013452
Sequence length 1092
Comment pep:known_by_projection chromosome:MEDAKA1:15:24752764:24766748:-1 gene:ENSORLG00000010727 transcript:ENSORLT00000013452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQLDETSFDLFEISHITRKTLGAKQFRGQNLDAPAYRFIRFDFLPPVDPPILKQILEQIQ
NNEGFVFVASMRQDHTSRGTLVALEGPGGRRQFEIISNGPANTLDLVYWVDGSQNVVSFE
DVDLSDSQWKNITLHIHGENANLFVGCNLLDSFVLDEPFYEHLRAEGSRMYVAKGSNREN
HFRGLLQSVRFIFDTPVESILQNRGCENSKDDPNTVRESTEVIDVRPSITTNIIGQKTDD
LGSDMCERSCEELSTMFHELKGLRVVVSNLIDGLQKVTEENTVMKEALGRMKETKEKNMC
WQDGRLFEDKEDWVVDSCTKCTCQESKIVCHQITCPPVACASPSFVDGECCPVCMPKDSE
DGWSPWSEWTECTVTCGIGTQQRGRSCDATSNPCSGPSIQTRKCSLGKCDSRVDGGWGPW
SPWASCSATCGGGIKSRTRECNSPQPQHGGKKCLGEASDSDSCNKKDCPIDGCLSNPCFG
GVDCSSSPDGSWECGPCPAGFRGNGTHCEDINECDMVSDVCYKVSGTQRCVNTNPGFHCL
PCPKRYKGTQPFGMGVESAKRNKQVCEPENPCKDKTHSCHKFAECIYISHFSDPMYKCEC
RTGYAGDGFICGEDSDLDGWPNQNLVCGANTTYNCQKDNCPDLPNSGQEDFDRDGQGDAC
DKDDDNDGILDERDNCALLYNPRQFDFDKDEVGDRCDNCPYEHNPAQIDTDHNGEGDACA
VDIDGDDIHNDNDNCPYVYNTDQKDTDMDGVGDQCDNCPLLHNPDQSDIDNDLVGDQCDN
NQDIDEDGHQNNLDNCPYVANANQADHDKDGKGDACDYDDDNDGVPDDKDNCRLTPNADQ
VDSDGDGRGDACKDDFDNDSIPDILDVCPENNAISVTDFRKFQMVHLDPKGTTQIDPNWV
VRHQGKELVQTANSDPGIAVGFDEFNAVDFSGTMYVNTDRDDDYAGFVFGYQSSGRFYVV
MWKQITQTYWEYKPSKAFGISGVSLKVVNSTTGTGENLRNALWHTGNTQGQVRTLWHDPK
NIGWKDYTAYRWHLIHRPKTGFIRVVVYEGKQIMADSGPIYDKTFAGGRLGLFVFSQELV
FFSDLKYECRGE
Download sequence
Identical sequences H2M4T0
ENSORLP00000013451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]