SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013490 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013490
Domain Number 1 Region: 28-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000989
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number 2 Region: 96-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000251
Family Fibronectin type I module 0.067
Further Details:      
 
Domain Number 3 Region: 224-268
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013490   Gene: ENSORLG00000010756   Transcript: ENSORLT00000013491
Sequence length 377
Comment pep:known_by_projection chromosome:MEDAKA1:4:18256434:18259175:1 gene:ENSORLG00000010756 transcript:ENSORLT00000013491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSREIATAIPNMVILLRVLSYPPSSCPSVCECQVEMPKCAPGVSVVLDGCNCCRVCARQL
NEDCSLTEPCDHTKGLECNFGASLAAATTRGICRAKSEGRPCEYNSRIYQNGESFQPNCK
HQCTCIDGAVGCVPLCPQELSLPNLGCANPRLVKVAGQCCEEWVCEDGKETDILEKIFGK
DKLTEELEKDLTNRNELIAIVKGGLKTLPAYRPQPEVYMFDSPKCIVQTTPWSQCSKSCG
TGISTRVTNNNNECKLVRETRLCEVRPCTQSSYASLKKGKKCNRTKKSSQPVKFTYAGCS
SVKKYRPRYCGSCVDGRCCSPHDTRTIQVKFRCEDGETFYKKTMMIETCKCTHNCPHVNE
ASYPFYRLSNDIHKFRD
Download sequence
Identical sequences H2M4W8
8090.ENSORLP00000013490 ENSORLP00000013490 ENSORLP00000013490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]