SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013494 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013494
Domain Number 1 Region: 27-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000738
Family Growth factor receptor domain 0.0051
Further Details:      
 
Domain Number 2 Region: 95-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000282
Family Fibronectin type I module 0.067
Further Details:      
 
Domain Number 3 Region: 223-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000366
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013494   Gene: ENSORLG00000010756   Transcript: ENSORLT00000013495
Sequence length 376
Comment pep:known_by_projection chromosome:MEDAKA1:4:18257205:18259099:1 gene:ENSORLG00000010756 transcript:ENSORLT00000013495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMLHSLVFFIGSLTLVLSYPPSSCPSVCECQVEMPKCAPGVSVVLDGCNCCRVCARQLN
EDCSLTEPCDHTKGLECNFGASLAAATTRGICRAKSEGRPCEYNSRIYQNGESFQPNCKH
QCTCIDGAVGCVPLCPQELSLPNLGCANPRLVKVAGQCCEEWVCEDGKETDILEKIFGKD
KLTEELEKDLTNRNELIAIVKGGLKTLPAYRPQPEVYMFDSPKCIVQTTPWSQCSKSCGT
GISTRVTNNNNECKLVRETRLCEVRPCTQSSYASLKKGKKCNRTKKSSQPVKFTYAGCSS
VKKYRPRYCGSCVDGRCCSPHDTRTIQVKFRCEDGETFYKKTMMIETCKCTHNCPHVNEA
SYPFYRLSNDIHKFRD
Download sequence
Identical sequences H2M4X2
ENSORLP00000013494 XP_004068081.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]