SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013620 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013620
Domain Number 1 Region: 38-238
Classification Level Classification E-value
Superfamily L domain-like 1.62e-32
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 2 Region: 287-372
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000028
Family I set domains 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013620   Gene: ENSORLG00000010862   Transcript: ENSORLT00000013621
Sequence length 509
Comment pep:known_by_projection chromosome:MEDAKA1:5:19662230:19665723:-1 gene:ENSORLG00000010862 transcript:ENSORLT00000013621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLWLKMLKGFWILLNISFLPCLNLVRADANLSQGGCLRASDILSCTALGLNQVPLELPVS
TVTLDLSHNKIEELKSGDFEGLLQLETLRLAHNQLTTIQPWAFRNSSGALLQHLDLSSNQ
LRVLEQHFFQELSGLRELLLFNNRMVRVETAALDGLRNLHKAYLSHNRLTDFPFFTIQKH
SHPHLSMLDLSSNRLFKLPLEDIKNLPELVQKGLYLHNNSLLCECSMFTLMRFYEQRGFA
SIKHFREEYICMINGIQRGILRFLLHSHYFDKCNLTVKIPALMEQESNVLVKEGAALLLH
CITTLSSHSITFFWVTPNLEYVALPGNNGSLKMFPNGSLEIVEARERDSGIFLCVAQDRQ
QNETWEVNVTVVGHHGEDHEPFNTGFTTLLGCVVSLVLVLMYLYLTPCRCPPCCRARPAT
TATPSQANEGVAGSAQSSILTPTPPTTTEGPGRKVSNNKHVVFLEPIKEQQNGRLRAGLG
LLLGMDQPKQRGGETDSFMCVFSDKSCCH
Download sequence
Identical sequences H2M595
8090.ENSORLP00000013620 ENSORLP00000013620 ENSORLP00000013620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]