SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013786 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013786
Domain Number 1 Region: 349-488
Classification Level Classification E-value
Superfamily C-type lectin-like 1.34e-40
Family C-type lectin domain 0.00021
Further Details:      
 
Domain Number 2 Region: 934-1083
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-37
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 3 Region: 1218-1357
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-33
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 4 Region: 1088-1218
Classification Level Classification E-value
Superfamily C-type lectin-like 1.65e-32
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 799-929
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-31
Family C-type lectin domain 0.00074
Further Details:      
 
Domain Number 6 Region: 634-784
Classification Level Classification E-value
Superfamily C-type lectin-like 2.98e-31
Family C-type lectin domain 0.0000628
Further Details:      
 
Domain Number 7 Region: 499-633
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-31
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 8 Region: 220-351
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-30
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 9 Region: 21-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.04e-28
Family Cysteine rich domain 0.0000198
Further Details:      
 
Domain Number 10 Region: 154-211
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-20
Family Fibronectin type II module 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013786   Gene: ENSORLG00000010988   Transcript: ENSORLT00000013787
Sequence length 1448
Comment pep:known_by_projection chromosome:MEDAKA1:20:18408915:18423095:-1 gene:ENSORLG00000010988 transcript:ENSORLT00000013787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRLACWIKFQSVVNKSLSFSDTGSFLIFNQDHNKCVKVETATSLTLAQCNPHAKQQQFRW
ASNSRLLSLSLKLCLAATEIKDWVKVVLFECDENSDLQHWQCKNDTLFGLKDQDLHLNWG
NRKERNLMIYQGSGVWSRWRMFGTMGDLCSKGFEEIFTLAGNAFGEPCQFPFKFQEKWYA
ECTRDGRTDGQLWCATERDYDKEKKWGFCSTQGSSGWDSDPVTGVQYQRNAQAALTWHQA
RKSCQQQGADLLSIVELHEQSYISDKGLTSHLGTSLWIGLNSLDFESGWQWSNGNPFRYL
NWGPGHPSSEPGLNCATINAGKASKWESNACTKKLGYICRKGNSTNLPPPPSTVKGPSFC
PSHWVPYAGNCYFLERSKKMWRDALAACRKDGGDLASIHSIEEQSFVISQTGYSQTDMLW
IGFNDQRNQLLFEWSDHSQVTFTQWDTGEPSHIINHQEDCVLIRGKDGKWADHTCEKMHG
YICKKKASTTMSEGNQEEVNPGCKLGSFRFGSFCYNIGSETKTFEEAKQACANSGGNLLD
IANRYENAFLVSLVGLRPEKYFWTGFSNTEDKTIFKWTTNRKVTFTHFNAGQPGKFKGCV
AITTGIFAGLWDVISCTNKEKYICKKVADNVQMTTVPPTTPALNCAPGWTPVVERNTCLK
EKIYRKESASKKTWQEAQDFCKTIGGDLLSIHSTRDLNNIERICINNHSVRFRSSAWIGL
RLQGTNEGFAWSDGSPFEFENWGYGEPNNHMDSEHCTEIHQYYGQYWNDRNCESYNDWIC
QIKKGKGVIPKPEPTVVEEVYNTTEDGWIIYNNSQFYVNNENLPMEAARAYCKKNFGDLA
VMTGDSERKFIWRQIARFSDMQYYIGMVVNLDKSFSWLDGTPVTYTAWNHNEPNFANNDE
NCVTIYREMGYWNDINCGLELPSVCRRSNSFINTTMAPTAVPNGGCAPQWILFKGKCYKF
FLGNNKNWRDAREFCTNEGGNLVSILNENEQAFLTIQMFHYNEDFWIGMNDVNWEMHFVW
TDGKGISYTNWAKGHPVSSPDGRYMMDEAFDCVIMTGNPAKLKGNWKVEDCGAKRGFICK
KNVDSQIVPPPTTPQNFYKLGNDSYKLIVQKMRWDEARRQCQADDADLASILNPVTQAYM
TLQMSSHNEPVWIGLNNNVTGGRFKWVDNWSLFYTKWGKDEPKSNYGCVYIDVDKTWKTA
PCTNTYYSVCKRSSEIAPTEIPQHPGSCPESKKQRNWIPFRGHCYSFRSSVVDNWAFASV
ECIKMGASLVSIQDPAEAMFIQKNLELLEDGAKTFWIGLYKSHDDEWMWIDKSVLDYTNW
KSGMPKSESCVDIHSDSGQWSTTSCNRYKSYICKTPKIIKPTEKLPAVASSAHVVQEVSH
ESAGIAVAIVLIVIAIVGLGAFLLLRKRTANPELGESTFDNMLYFTNLFRTGGDTKGLVV
NIEENEQA
Download sequence
Identical sequences H2M5Q4
8090.ENSORLP00000013786 ENSORLP00000013786 ENSORLP00000013786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]