SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013845 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013845
Domain Number 1 Region: 618-786
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.83e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.000074
Further Details:      
 
Domain Number 2 Region: 52-259
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.54e-42
Family DBL homology domain (DH-domain) 0.00066
Further Details:      
 
Domain Number 3 Region: 275-343,401-435
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 478-588
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000327
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013845   Gene: ENSORLG00000011038   Transcript: ENSORLT00000013846
Sequence length 836
Comment pep:known_by_projection chromosome:MEDAKA1:14:20928891:20996734:1 gene:ENSORLG00000011038 transcript:ENSORLT00000013846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYNTDGYEGEGAEDGKSQDGSETLPYIDESPTMSPQLCVAQGPDGEPISPTPPEGLHEGD
LGKGLEMKKLVLSGFLTSEEIYINQLEALQLPLRPLKATATTSQPVLTMQQIDTIFYKIQ
DILEIHKEFYDALSPSIQQWDEKVTVGHLFKKLASQLGVYKAFVDNYKIALETAEKCSQA
NIQFQKISENLKVKGPKDSKDCSTVSMEALLYKPIDRVTRSTLVLHDLLKHTPEDHPDFP
LLQDALRISQNFLSSINEEIDPRRTAVTTPKGEARQLVKDGFLVEVSESSRKLRHVFLFT
DLLLCAKMKKTAVGRHQQYECKWYIPLADLTFQTPDDSDPCPSIQVLPEHEIEEMKMKIS
VLKNEIQKEKKAPKGQSRVERLRKKMNEQESWLLLHSPTIPFRVHNKHGKTFLFLLSSDY
ERSEWRESIQKLQKKDLQVCILTTYELQVLTNSCVKLRTVHNIPVTGNKDDEESSGLYGF
LHVIVHSAKGFKESANLYCTLEVDSFGYFVSKAKTRVFRDTAEPSWNEEFEIELEGSQYL
RILCYENCYDKSMLNKDDNEIVDKIMGKGQVQLDPQTVQSKNWQMDVIEMNGIKVEFSMK
FTSRDLSLKRTPSKKQSGVFGVKISVVTKRERSKVPYIVRQCIEEVEKRGIDEVGIYRIS
GVATDIQALKLAFDTNTKDILMMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGI
ALSDPAAKENCMMHLLRSLPEPNIMTFLTLLDHLKRVAEKEPVNKMSLHNLATVFGPTLL
RPSESESLKGQHIMSATDIWSHDVMGQVQVLLYYLQHPPISYAELKRNTLYFSTDV
Download sequence
Identical sequences H2M5V9
8090.ENSORLP00000013845 ENSORLP00000013845 ENSORLP00000013845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]