SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014015 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014015
Domain Number 1 Region: 8-138
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-38
Family DBL homology domain (DH-domain) 0.00063
Further Details:      
 
Domain Number 2 Region: 119-254
Classification Level Classification E-value
Superfamily PH domain-like 9.76e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 231-311
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000048
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014015
Domain Number - Region: 358-392
Classification Level Classification E-value
Superfamily PH domain-like 0.000822
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014015   Gene: ENSORLG00000011170   Transcript: ENSORLT00000014016
Sequence length 395
Comment pep:known_by_projection chromosome:MEDAKA1:7:17582281:17591409:-1 gene:ENSORLG00000011170 transcript:ENSORLT00000014016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQVWKDSNPRIGDILQKLAPFMKMYGEYVKNFDRAMDLVNTWTQRSSQFKSVVQNIQKQD
VCGNLTLQHHMLEPVQRIPRYELLLKDYLKKLPSDAPDQKDAAKALELISTAANHSNAAI
RKMEKMHKLLEVYERLGGEEDIVNPANELIKEGHIKKMSAKNGTAQDRYLYLFNNMVLYC
VPKLRLMGQKFSVRERIDIAGMEVQENVKQNLPHTFAIIGKQRSLELQARTAEEKEDWIQ
VIIATIERHKQNSETFNKAFISSFSRDDDHVPDSPLQKTSKKKEKEKQTCKGCNESFNFT
KRKHHCKTCGAVSTNGKKENHTDQRRKAAPECYAFLMGFIKGSKAKERQPSLTAENCLLS
GYLQVQEKGKSWTKMWVAVTKTEPLVLYLQSSAQV
Download sequence
Identical sequences H2M6C4
ENSORLP00000014015 ENSORLP00000014015 8090.ENSORLP00000014015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]