SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014038 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014038
Domain Number 1 Region: 1163-1387
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-58
Family DBL homology domain (DH-domain) 0.0000000559
Further Details:      
 
Domain Number 2 Region: 1387-1523
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-28
Family Pleckstrin-homology domain (PH domain) 0.00000285
Further Details:      
 
Domain Number 3 Region: 207-303
Classification Level Classification E-value
Superfamily EF-hand 3.2e-26
Family Eps15 homology domain (EH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 1087-1167
Classification Level Classification E-value
Superfamily SH3-domain 8.27e-25
Family SH3-domain 0.0000598
Further Details:      
 
Domain Number 5 Region: 1540-1660
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-24
Family PLC-like (P variant) 0.0089
Further Details:      
 
Domain Number 6 Region: 12-105
Classification Level Classification E-value
Superfamily EF-hand 4.18e-24
Family Eps15 homology domain (EH domain) 0.0016
Further Details:      
 
Domain Number 7 Region: 705-767
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-19
Family SH3-domain 0.00024
Further Details:      
 
Domain Number 8 Region: 870-944
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-18
Family SH3-domain 0.0000935
Further Details:      
 
Domain Number 9 Region: 950-1012
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-17
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 10 Region: 1014-1089
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000144
Family SH3-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014038   Gene: ENSORLG00000011188   Transcript: ENSORLT00000014039
Sequence length 1667
Comment pep:known_by_projection chromosome:MEDAKA1:3:23564359:23586086:-1 gene:ENSORLG00000011188 transcript:ENSORLT00000014039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFTFTSPVSGVTNMWAISPEERGKHDQKFDTLSPSMGYITGEQARTFFLQSGLPAQVLAE
IWALADLNKDGKMDRLEFSIAMKLIKLKLQGTPLPSTLPIIMKQTPVSLSGLNNPNPAYG
MLFAVIGMGPMTIINGPVITPIPMSNPGLSQIPGLSTPLLNGTILQPMPVGALTTDGWKK
SLSSSAMSSSSSSSSPLMKFLMSAVPSDWAVPQSSRLKYRQQFNILDKQMKGYLSGLQVR
SAMATTMLSQTQLASIWNLSDVDKDGNLKAEEFILAMHLVDLAKSGQPLPSLLPPELIPP
TLRYADAKKTLQKLLPKATFNQRTGPAASAETQSQLFELSFLVSFEDKFKANVEQGNAEL
VKRRLALLLYSLLRDMQAGSYADVHHCHAAQRELERQRKVELEKRRRSDLQKKKEQEQNE
IIKLKAKKRSLEMELEAVGNKHRQISDRLRDIRNKKKLQKTELDLTNQRKETCQQDITSL
QKQIEEFQRKLSQLTPEQKRLSEKLRNMAVNNLPVSSIATMKVTAAEKKGTCMKLREQLE
ALEKESSTRLAEIERYNKDMQDLRESQRKQQAALENLRRIKEEKQGELKRKQQEEQRKRQ
EEERKRREEEERQKRIQIEKERQWQEKLRRDEEERQRKLREEREAKQREEEEKERQALIQ
AAMEQAERASRQPQANGGKLDIQGRISCSGGQPKATQHRKSAALTSFKALYPFTPRNNEE
LSLNEGDIIEVDETTEKEEGWLYGSRQGKMGWFPESYVERVGPSTSVENSAAAPAKMPLQ
AQLSNASKSAFTPTHSLGSAPSETHGQCGNAPMMKILDPSQVGELAKSQGDQILIDLTAN
DRTLYHRHLRHQYTNVSNVTLLHHQATVSLLAQALCSWTAKTDNHLNFNKDDVIHVLEQQ
ENWWLGELNGDRGWFPKTYVSVLGEDDSSERVNKPQPKTTSTAQRRGQGCALLPEFVALY
AYKSPQAGDLTFTEGDVILVSKREGEWWNGSTGDRTGLFPHNYVKPKEADTSSITGKKKQ
EVAQVIKAHSSAVPEQLNLEVGQLILIFHKNPSGWWLGELQARGKKRRKGWFHCSNVKVL
SSNSGKSTPAPQPGITSSSPTVCQVIAMYDYTAANKDEMSFSKGQLINVLDKNDPDWWKG
EVDGVTGLFPTNYVKMTLDTEPSQQWCSDQTSLDSLSPLEKKRQGYIHELMDAEEKYVDD
LQVVLEVFHKPMSESGRLTDSEMAMIFVNWKELLACNTKLVKALRVRKKTTGENMPVQMI
GDILAAELSHMQPYISFCSCQINGASLLQTRTDNEPDFKEFLKIKKLGTDYRCKGMPLSS
FLLKPMQRITRYPLHIKNILDSTIEGHADRGPLKEALERAEELCQQVNEGVREKENSDRL
EWIQNHVQCDGPAENLVFNSLTNCLGPRKLLHSGKMYKAKSNKELWAFLFNDFLLLTHAA
KQFSSSGPDKLFSNRNNVQLKMYKPPVLLNEILAKISDSSSDEPTFQITHIDRVYVLKTE
NINERTAWVQKIKAASEEFIETELKKREKAYQGRSIKVSGIGRLLVTILEATELKATRPN
GKSNPYCEVNVGAQVFTSRTLNDTLNPKWNFSCQFHLKDLYQDVLCITISDRAQFSPDEF
LGRTEIPVATIKKEMENKGSVTRRLLLHEVPTGEVWVRLDLQLYASR
Download sequence
Identical sequences H2M6E4
ENSORLP00000014038 8090.ENSORLP00000014038 ENSORLP00000014038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]