SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014129 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014129
Domain Number 1 Region: 30-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000199
Family VWC domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014129   Gene: ENSORLG00000011273   Transcript: ENSORLT00000014130
Sequence length 1478
Comment pep:known_by_projection chromosome:MEDAKA1:19:15148007:15166843:-1 gene:ENSORLG00000011273 transcript:ENSORLT00000014130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSFVDIRLALLLSATALLVRGQGEDDNRSAGCEMNGEFYNENDVFKPEPCKMCTCQNGQ
PLCDEVYCEDILDCEDPYIPEGECCPVCNAFWHHPVSSHGQEDYKIDETDITEMPEGPEG
PRGDPKCNASLGQRGHKSPQGPAGPPGRDGIPGQPGLPGPPGLPGAPGTTGIGGNFSPQM
SFDPSKSSGPPVPGPMGPLGPRGPPGPPGASGPQGFNGPPGEPGEPGASGPMGPRGPGGP
PGKNGDDGEPGKPGRPGERGSAGPQGARGFPGTPGLPGIKGHRGFSGLDGAKGDAGPAGP
KGEPGAPGENGIPGAMGARGLPGERGRPGAPGPAGARGNDGNTGAAGPPGPTGPAGPPGF
PGGPGAKGETGPQGGRGAEGPQGARGEPGNPGPAGAAGPAGNPGSDGNPGAKGSPGMAGI
TGAPGMPGMRGPPGGQGAVGAQGQKGNNGDPGPPGPKGEAGAKGEPGPAGLQGLPGPSGE
EGKRGPRGEPGGAGARGAPGERGAPGARGFPGADGAGGPKGAPGERGAPGPMGPQGATGE
SGSPGAPGAPGSKGVTGSPGSPGPDGKAGPAGAPGQDGRTGPAGPPGARGQPGVMGFPGP
KGSSGENGKPGERGPAGPVGAVGAPGKDGDVGAPGPAGPAGAAGEKGEQGPAGPNGFQGL
PGPQGATGETGKPGEQGVPGEAGPPGPSGARGERGFPGERGGNGPAGPAGPRGAPGSAGN
DGPKGEPGAAGAPGGVGSPGMQGMPGERGAAGLPGVKGERGDPGGKGADGAAGKDGVRGM
TGLIGMPGPPGPQGEKGEPGPVGVAGLTGPRGSPGERGENGPPGPAGFAGPPGADGQPGL
KGESGDTGPKGDAGAPGPAGPVGAAGPQGPAGPPGPKGARGGAGAPGPTGYPGPAGRVGP
PGPAGAAGPPGPVGPVGKDGARGQRGETGPAGRPGEAGAAGPPGPPGEKGSPGSDGAAGT
PGAPGPQGIAGQRGIVGLPGQRGERGFPGMPGPAGEPGKQGASGPVGERGAPGPAGPPGL
SGAPGEAGREGSAGNDGAPGRDGAPGPKGDRGESGTPGPPGPPGAPGAPGAVGPSGKAGD
RGETGPAGPSGPAGPAGVRGPAGPAGAKGDRGETGEAGERGHKGHRGFTGMQGLPGPAGP
SGERGPAGSSGPAGPRGPAGNNGSPGKDGVNGMPGPIGPPGPRGRNGDMGPAGPPGPPGL
PGPPGPPGSGFDFVSQPIQEKAPDPLRGGYRADDPNMVRDRDMEVDTTLKTLSQRVEKIR
SPDGSQKSPARMCRDLRMCHPEWKSGMYWVDPNQGSPLDAIKVHCNMETGETCVSPSQSS
IPMKNWYRTKNIREKKHVWFSESMTGGFQFQYGGSEADPEDVNIQIAFMRLMSNQASQNI
TYHCKNSIAYMDSATGNLKKALLLQGSSDTEIRAEGNSRFTYSVSEDGCTSHTGTWGKTV
IDYKTPKTSRLPIIDIAPMDVGGPDQEFGVEVGPVCFL
Download sequence
Identical sequences H2M6N2
ENSORLP00000014129 8090.ENSORLP00000014129 ENSORLP00000014129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]