SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014130 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014130
Domain Number 1 Region: 992-1277
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.14e-80
Family Complement components 0.000000509
Further Details:      
 
Domain Number 2 Region: 1503-1657
Classification Level Classification E-value
Superfamily TIMP-like 4.32e-42
Family Netrin-like domain (NTR/C345C module) 0.001
Further Details:      
 
Domain Number 3 Region: 1351-1503
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.83e-35
Family Alpha-macroglobulin receptor domain 0.00073
Further Details:      
 
Domain Number 4 Region: 666-739
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 6.67e-20
Family Anaphylotoxins (complement system) 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014130
Domain Number - Region: 820-866
Classification Level Classification E-value
Superfamily E set domains 0.0136
Family SVA-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014130   Gene: ENSORLG00000011267   Transcript: ENSORLT00000014131
Sequence length 1659
Comment pep:known chromosome:MEDAKA1:1:30464806:30494393:-1 gene:ENSORLG00000011267 transcript:ENSORLT00000014131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRALQLLLASLALVSLMSLIDAGPLNLMSAPNLLRVGTPENIFVECQDCSGANQPVTIS
VKNHPTKAKTLATTQVTLTNDNNFQGFGQITIPPGDFSKDPSVKQYVYLEAAFPGRTLEK
VVMVSFQSGYIFIQTDKTLYTPNSKVYYRMFGVTPRMEPLERLNDAQTDTSISIEIVTPE
GIILPLDPVSLKSGLHSGDYQLNEIVSPGLWKIVAKFQSNPQESFSANFEVKEYVLPSFE
VKLSSLRPFFYVDSETLEIDIKARYLFGQEVNGNAYVVFGVMDQGQKKSFPDSLSRVPIE
NGEGKVVLKREQITKTFQDINQLVGTSIFVSVSVLTESGSEMVEAELRGIQIVKSPYTIT
FKRTPKYFKPGMSFDVAVEVLNPDESPAGNIPVVVTPGPVRGFTAANGMARLTINTATQD
ERLSISAKTDDPDISLNRQAEATMQANQYSTNSKTYIHIGVDTPEVKLGDNLKVNLNLNK
QPGGNQDITYLITSRGQLVKFGRYKTRGQVLISLIIPVTQEMLPSFRIIAFYHPSDNEVV
SDSVWVDVKDSCMGSLTLEPKTPAASYEPRKMFSLKVSGDPGATVGLVAVDKGVYVLNSK
HRLTQKKIWDEVEKFDTGCTPGGGKNGLSVFFDAGLLFESSTASGTVYRQEKKCAAPSRR
RRASTIMDVRTTLLSQYKEDLQRECCLDGMKDSPVSYTCERRSEYIMDGGQACVDAFVTC
CKEMEKQQLEKKEESLQLARSETDDSYMDSNEIVTRSNFPESWLWSDIILPQCPPNTPNC
GSTSSVKNVPLQDSITTWEFTGISLSRTHGICVGESLEVIVRKDFFIDLRLPYSAVRGEQ
LEVKAILHNYRPELITVRIDLAEEKDTCSAASKRGKYRQEVNVGAMSTRSVPFIIIPMKE
GTLPIEVKAAVKDSYLSDGVKKDLRVVPPGVLVKAIESTILDPAHKGKNGEQVEVLNSNI
PKSNFIPSSPTSTQISLTGREQVSGLVENAISGKSMGTLIYQPSGCGEQNMIHMTLPVIA
TIYLDKTNQWEAVGFQKRAEALQHIKTGYTNELAYLKGDGSFAVWADHGSSSWLTAYVIK
VFSMANNLVAIKKEHICDAVKFLILRAQQPDGLFTETGKMYHGEMIVISCPRFQLRCLYD
SVLPHCHAGRSLCSATVNTLPGSIDKAVAYLEKRLPSLTNPYAVAMTSYALANEGKLNRD
ILYKFVSPELTHWPVPGKHLFTLEATAYALLALVKTKSFEDARPVVRWFNQQQFVGGGYG
STQATIIVYQAVAEYWANAQEPEYDLKVDILLPGKSKPDKYEFNRENSYATRTSKIKDIN
KDIKVKATGSGEAVLKMVSLYYALPEEKESDCQKFNVSVQLLPAAKNIGNQKVYKLQIEV
LYKDSNRDATMSILDIGLQTGFTPNLDDLKALSGGRFPLISKYEMNTALSERGSLIIYLD
KISHTRPEEISFRVQQTMEVGVLQPAAVSVYEYYEQTPCVKFYHPEREGGQLLKLCKDDE
CTCAEENCSMQKNGQISNDERTSKICESTESSKIEYAYKVLVEDVVQKPSIDIYAMRVQD
SIKEGSTDVGPRGKLRPFLSYPHCRDALKLQKGKTYLIMGSSRDIHKDEKQLTYQYVLGE
RTWIEYWPTAEECQGDEHRATCLGLDEMLEQFRVFACQQ
Download sequence
Identical sequences H2M6N3
8090.ENSORLP00000014130 ENSORLP00000014130 ENSORLP00000014130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]