SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014148 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014148
Domain Number 1 Region: 30-184
Classification Level Classification E-value
Superfamily TIMP-like 6.28e-43
Family Netrin-like domain (NTR/C345C module) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014148   Gene: ENSORLG00000011292   Transcript: ENSORLT00000014149
Sequence length 186
Comment pep:known_by_projection chromosome:MEDAKA1:1:30513977:30524989:-1 gene:ENSORLG00000011292 transcript:ENSORLT00000014149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTETPCVKFYHPEREGGQLLQLCRDDECTCAEENCSMQKNGQISNDERASKICESTESSK
IEYAYKVLVEDVVHKPSIDIYAMRVQDSIKEGSTDVGPMGKLRPFLSYPHCKDALNLLKG
KTYLIMGSSRYIHRDEKQQTYQYVLGERTWIEYWPTAEECQGDEHRATCMGLDEMLEQFR
VFACQQ
Download sequence
Identical sequences H2M6Q1
8090.ENSORLP00000014148 ENSORLP00000014148 ENSORLP00000014148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]