SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014162 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014162
Domain Number 1 Region: 879-1023
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-19
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 987-1112
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 595-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000332
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 4 Region: 745-906
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000111
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 669-714
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000266
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000014162
Domain Number - Region: 104-151
Classification Level Classification E-value
Superfamily FnI-like domain 0.00146
Family VWC domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014162   Gene: ENSORLG00000011304   Transcript: ENSORLT00000014163
Sequence length 1221
Comment pep:known_by_projection chromosome:MEDAKA1:7:17750827:17772639:-1 gene:ENSORLG00000011304 transcript:ENSORLT00000014163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASQKDCSGVVCPVLQNCIETVLETGACCPKCMERGCICEGYQYYDCIQVGFQNGRVPEGE
SYFVDFGSTECSCPQGGGKISCRFIQCPEIPPNCIDVLQPADGCSECGRIGCTHGNKKYE
AGHSFRADNCQVCHCPNEGGKIMCSPIPDCDLHSVDKSIGDPPRVGSEDHDYSREEPTSS
TILNLAQLVESSTLPLSYPESNATLISHGGRRNEKKQTQRKPNLVRSTEEKPSQSMNQTS
AGAQTRASPTTTTKEGMATEIHRQQQELGERSTRVYAAAEQLCALGWKDHDEMFTRTTGT
PEKLVNERRISKLFRQERGNSPPWSLAVVFDASSILGRFENPTHISPEGRIGNFPMFLVV
NSPWAREPIPPQDLLMIASCLSVILWIPVLKRSDLKEKIKLLKTHFNENGAFNMFLWHFS
DDEMSAKELMKTCCETGEKWASANGHCNNMEPPTKDRQSICWTAQQQCCLGSLTEAQCLA
GINAARAGRTCREGASTKCGIHSYKDCCGCCSLGLQFRKEGHACEAHHSLGYHCQHIFLT
CCEGKEIKPTIRERPALDTTSAPRKVSDGLFPREAFSMGEDRDGENAVEGPVEVEDMDEC
LIYKGRICHHRCVNTPGSYRCECYPGHVLQEDAITCAQDSVDEENRLKEIDRTAVKNTSP
PLPPTLPAVPINPCEGNICEQQCVLVAGRPQCSCSLGFSLKADGRSCEANIFCLIAAQIL
EMLRVELILNPIGFFHPIHFGNLKCYLWYVNSHCECIDVNECLSSNACLLNERCMNTQGS
YVCQRLITCLPGQQINNDVCEDIDECAQRSHNCAVDSECVNTQGSFRCSPKARCAGGFIK
DTQGNCVDIDECGTLTQTCNPRSSCINTVGSYICNRRIICSRGYHASPNGSRCVDVNECE
SSLHQCGEGQLCVNLPGSYRCECQAGYQYDSFRRMCTDVNECWRYPGRLCAQTCVNTPGS
YECSCTSGFRLSGDSKNCEDVNECLANPCSQECANIYGSYQCYCRQGYYLREDGKTCDDI
DECSRSIGPLCTYKCVNVPGSYRCACPEYGYTMSSNGRSCIDIDECAAGVHNCSLADTCY
NIQGSYRCLSLSCPQNYRKVSDTRCERISCPNYLECQNSPLRITYYYLSFQSNIVIPAQI
FRIGPSPAYSGDNVIVTITQGNEENYFSTRKLNAYTGAVFLQRQVQGPRDFLITVEMKLW
RQGAFTTFQARIYVFITANLL
Download sequence
Identical sequences H2M6R4
8090.ENSORLP00000014162 ENSORLP00000014162 ENSORLP00000014162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]