SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014183 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014183
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-39
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 238-386
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-21
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014183   Gene: ENSORLG00000011323   Transcript: ENSORLT00000014184
Sequence length 411
Comment pep:known_by_projection chromosome:MEDAKA1:6:16675326:16688224:-1 gene:ENSORLG00000011323 transcript:ENSORLT00000014184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPDSHVRKRQEAIWELFTSECVYFLDQLMVLNEVFLVTLSNLQLRNCLTDVNVWSLFAN
VNELCLVSSSFLRNLLNVIKDTLEITESGGPTLLELLSKAFKESICNSLQKYCLNYSSAL
LYLDSLKLREDFGSYLKWCERKEQCRRLQLRDLLVAPLQRLTRYSLLLRNVAKRCQEEEE
RRGMQVIAEQVDTSICDLEGKVKWLHNFQKVKLLRDALVWTPVWERDKRAFIPETLKHLL
KTVTADNLISHRSLLHEGKLVLTENTKLIDAYLFLFDEFLLITKIKKNKKRSLTSDQNPL
RVQQQNLELDQLLKEGSTFTVLDQPISLDRLQLKNIDQLNASTSGLPHSFIIMHHNRYQQ
CIGAFILQAASESAKREWISKIEGAVTEQLKLDSEHPRVQSSSSWLESSQI
Download sequence
Identical sequences H2M6T5
8090.ENSORLP00000014183 ENSORLP00000014183 ENSORLP00000014183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]