SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014322 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014322
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily Bet v1-like 4.94e-84
Family Phoshatidylinositol transfer protein, PITP 0.00000965
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014322   Gene: ENSORLG00000011438   Transcript: ENSORLT00000014323
Sequence length 293
Comment pep:known_by_projection chromosome:MEDAKA1:16:16541556:16551918:-1 gene:ENSORLG00000011438 transcript:ENSORLT00000014323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRIGQLYMISKHCCEQSDGGEGVEVVRNEPDMHPEHGAGQLTEKRIYLSSKLPSWAKAFV
PRIFYVTEKAWNFYPYTITEYSASFIPKFSIRIETRFEDNNGNNDRVFGDTPTPAENVSF
LDILSDPIPEKHYKESEDLSRWRSSKTNRGPLEIGWKDHHKPIMCSYKRVHCSFEVYGFQ
TRTEDFVHRSIKDILLVAHRQAVAWLDEWHGSCALSKGLSLDEVREYEGKMQEKTNSKVK
SGQCNTVPQVPSRPGFFRSFSVTDEQSLKKRGMTTAASSASSVPHGRHNSTPE
Download sequence
Identical sequences H2M770
ENSORLP00000014322 8090.ENSORLP00000014322 ENSORLP00000014322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]