SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014794 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014794
Domain Number 1 Region: 51-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-18
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 2 Region: 213-270
Classification Level Classification E-value
Superfamily LCCL domain 0.00000000000157
Family LCCL domain 0.0022
Further Details:      
 
Domain Number 3 Region: 273-336
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000134
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014794   Gene: ENSORLG00000011807   Transcript: ENSORLT00000014795
Sequence length 336
Comment pep:novel chromosome:MEDAKA1:21:10544797:10555669:1 gene:ENSORLG00000011807 transcript:ENSORLT00000014795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFHWAFLSSTVMNRKSRHLSSSLALSIFVILTAEGCGAQKGDGCGPSVLGPSSGTLSSR
GYPRTYPNNSVCEWEISVPRGKRIHFRFAFLDIEDNNCQVNYLRLYNGIGTKRSEIGEMT
NAHGMGLTQSHQFVWKGEYIKLTFVERSGLFTSSRPILVSSPQVTGLQKRYLITCSDKGR
DFSEAEFRCERTGRGGSVAPSRNRSGPGSENETETSPLCTAAIHAGVVSNALGGRIHVLS
SKGISRYDGALANGVTSTGGNLSNSLFTFRTNGCYGTLGLQTGAVADSQLTASSALGAFI
TGQDSEWGPSGARLKQAGLPWAPSSSNHQQWLQVDL
Download sequence
Identical sequences H2M8H8
ENSORLP00000014794 8090.ENSORLP00000014794 ENSORLP00000014794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]