SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014890 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014890
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily Bet v1-like 7.42e-72
Family Phoshatidylinositol transfer protein, PITP 0.0000000742
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014890   Gene: ENSORLG00000011886   Transcript: ENSORLT00000014891
Sequence length 239
Comment pep:known chromosome:MEDAKA1:9:17665883:17681515:-1 gene:ENSORLG00000011886 transcript:ENSORLT00000014891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVEVRESRYSKMSRMKKMEKKDSIHTKSTTYRVKSQHLSGFLPQKAPWYFMKKHGMHT
LTAELLQNEYMKDNFFIKIETWHKPDMGTQENVHNLDASTWKNVTVVPIDIADRSQVSNA
DYKPDEDPAKFKSAKTGRGPLGPDWKKELVSNAECPRMCAYKLVTVKFKWWGLQTKVENF
IQEQEKRIFNNFHRQLFCWIDKWVELTMDDIRRMEAETQKELEELRRRGEVRGTSAADQ
Download sequence
Identical sequences H2M8R9
ENSORLP00000014890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]