SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015059 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015059
Domain Number 1 Region: 588-777
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-51
Family DBL homology domain (DH-domain) 0.0000000274
Further Details:      
 
Domain Number 2 Region: 782-920
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-38
Family Pleckstrin-homology domain (PH domain) 0.000000452
Further Details:      
 
Domain Number 3 Region: 285-422
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000734
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 4 Region: 110-193
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000275
Family CRAL/TRIO domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015059
Domain Number - Region: 429-523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0135
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015059   Gene: ENSORLG00000012020   Transcript: ENSORLT00000015060
Sequence length 923
Comment pep:known_by_projection chromosome:MEDAKA1:21:11261317:11279332:-1 gene:ENSORLG00000012020 transcript:ENSORLT00000015060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRIEHEALQCECSHSLSSVLLFIPDEIMQLDSSPLRAADITTDLKKQFAFLSGGRGDNGS
PVIVFPEFPAFSEITDREFHNVLSYLTSVPSLSSTDVGFILVIDRRQDRWAAVKGTLLRI
AGSFPGNLQLVLVLRPTTLLQRTLSDILFKFNKDDFKMKVPVIMLSSLTELHSYIDRSQL
TQELGGTQEYCHEKWISHRTAIEGFALMVKRTAQALQSFGTELAETELPNEIQATTILLS
THTNKRDKMKEDLLVALGQGSRLLESINEPIMHNPDHNMNQDELENLATVQRLLSQLDET
ERAFDEFWLRHQTKLQQCLQLRHFEHNYREVRALLDQTSEKLTSFSEVGISPAHADHIFT
ELTTFEERVCEVLDKALALSREGDELIQNSHYDEDSIQPKCCELRALSESTSSSLRAKKD
HLLKAIELHHRLDRTSKWVDDGIYLLASQPVDKCQSHEGAEVALQELERYLDNAGCSQLT
DLSSIWTEYEGVLNHQLREQVEKVYQKQTSMQEMFDKRTVSLKKLAAKQLRPVQPVAPRP
EAFIKSPLNSPAHRVQQEINSSDSDNSCGKGQQQNEDGNSRHASLSEEEENLAVLRRHVM
NELLETERVYVEELLCVLQGYASEMDNPGMSHLIPPSLNNKKEVLFGNMPEIYHFHKRTF
LRELEQYTDCPELVGRCFLQRMTDLQIYEKYCHNKPRSESLWRQCSDCAFFHECQKKLEH
KLGLDSYLLKPVQRITKYQLLLKEMLKYSRGREGADDLQEALTSIVGILKAVNDSMHLIA
ITGYEGNLSELGKLLMQGSFSVWTEHKKGHAKVKDLARFKPMQRHIFLHEKALLFCKKRE
ENGEGYEKAPSYSFKQSLSMSAVGITENAKGDNKKFEIWCNSREEVYIVQAPTADMKTTW
VNEIRKVLTTQLEACREASQQRA
Download sequence
Identical sequences H2M977
ENSORLP00000015059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]