SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015112 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015112
Domain Number 1 Region: 213-253
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000523
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015112   Gene: ENSORLG00000012072   Transcript: ENSORLT00000015113
Sequence length 456
Comment pep:known_by_projection chromosome:MEDAKA1:15:26997187:27008446:-1 gene:ENSORLG00000012072 transcript:ENSORLT00000015113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLAAELLLLLGLLLLTLHITVLRSSPLPQANATRSLDRDAAPAEKNKNGRSRSSSHLA
PENRGSGPEHRTSHQPASHPWTQDGSVRRDGHGSFLLDLHNFPDLSKADINGQNPNIQVT
IEVVDGLEGHEPEKGFRKESKPSWASPNWRNWWPRTSSSSSSSSSTHQTGVRDRSYGGKT
ADSNFLRPPADWDRKGSKTQTEYVIQDYMDGDGDWSNWSACSVTCGNGNQKRTRSCGYAC
TATESRTCDMPNCPGIEDTFKTAATEVSLLAGTNEFNATELFGVDTDSCERWMNCKSDFL
KKYMTKVANDLPSCPCSYPTEVAYSTADVRDAPTRRDFRWKDASGPKEKLEIYKPTARYC
IRSMLTLESTTLAAQHCCYDDNMKLITRGKGAGTPNLISTEFSADLHYKVDILPWIICKG
DWSRYNQARPPNNGQRCPENPQDEDYYKQFEEAREF
Download sequence
Identical sequences H2M9C9
ENSORLP00000015112 8090.ENSORLP00000015112 ENSORLP00000015112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]