SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015124 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015124
Domain Number 1 Region: 612-918
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-84
Family Protein kinases, catalytic subunit 0.000000000556
Further Details:      
 
Domain Number 2 Region: 437-530
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-30
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 3 Region: 94-188
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-23
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 4-100
Classification Level Classification E-value
Superfamily Immunoglobulin 4.76e-19
Family I set domains 0.0085
Further Details:      
 
Domain Number 5 Region: 179-263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000692
Family I set domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015124
Domain Number - Region: 291-378
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.000379
Family Frizzled cysteine-rich domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015124   Gene: ENSORLG00000012082   Transcript: ENSORLT00000015125
Sequence length 931
Comment pep:known_by_projection chromosome:MEDAKA1:12:20424074:20477501:1 gene:ENSORLG00000012082 transcript:ENSORLT00000015125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRIITLLETVDVLLDHNATFICEVESRPPAIITWTKNNHPIKYYDTRYLTREKGQMLVI
PHVRESDNGEYCCLASNGIGEPAKSCGALQLKMKPQIKQQPRNLTLVITSKAVLPCFTLG
NPKPEITWLKDNNPVKFSEGITILDSGALKIHNIQKEDAGQYRCVAKNSFGLALSKTVTI
EVQAPARILRAPKEKRAPSGSQITLECNATGIPIPTITWLENGNAISGASVEETIVGDVI
LSVLKVTVVKHALYTCMASNRHSGGANTVKATAGVTVAEWRRLFKSSSGYCSAYRGEVCQ
TVLQDNFLVFFNASLSDPEDMQEYLVQSWWTELEGLSTLCSPALLSLLCHSSFPNCNPSG
LGPAPKPVCREHCLAVKELYCYKEWLLLEGSRSVQPELFDSVLGSHYLPKCQALPSLHAD
PDACTHVPFLDLSKDEITTTCYNDKGRLYQGNINVTRSGIPCQPWNQQQVPHQHRLSVDI
IPELKNSHNHCRNPGGISDRPWCYTSNPNIRLEYCVVPQCGKTTIPPAVIKPESTRQNPH
LPPTTSVSSPAYSMSVIVIVLTSFAITVALSIVILSCYRRRKQWANRKRREMKMPTLSAL
PSELLLDRLHPNPMYQRVPLLLNSKLLGLEYPRNNIQYVRDIGEGAFGRVFQARAPGLLQ
NKPFTMVAVKMLKEEASPDMQNDFQREAALMAEFDHPNIVKLLGVCAVGKPMCLLFEYMA
NGDLNEFLRRHSPTQSMHTLSCPSISNRSFSSDMEAGSLSCVQQLSISKQIAAGMAYLSE
RKFVHRDLATRNCLVGEEMVVKIADFGLSRNIYSADYYKANENDAIPIRWMPPESIFYNR
YTIESDVWAYGVVLWEIFSHGMQPYYGMGHEEVIYYVRDGQILACPENCPLELYNLMRLC
WSTQPSDRPSFSSIHRILERMHQNKLNTNTD
Download sequence
Identical sequences H2M9E1
ENSORLP00000015124 8090.ENSORLP00000015124 ENSORLP00000015124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]