SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015144 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015144
Domain Number 1 Region: 137-451
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.44e-78
Family Papain-like 0.00000449
Further Details:      
 
Domain Number 2 Region: 111-139
Classification Level Classification E-value
Superfamily PMP inhibitors 0.00000471
Family PMP inhibitors 0.002
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015144
Domain Number - Region: 69-95
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00615
Family Somatomedin B domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015144   Gene: ENSORLG00000012101   Transcript: ENSORLT00000015145
Sequence length 465
Comment pep:known_by_projection chromosome:MEDAKA1:11:21968728:21990355:1 gene:ENSORLG00000012101 transcript:ENSORLT00000015145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLTITALLLLVGESTSERILSRRTKRELAGPLHVGGIRDPFGSYCQRRGGCCPGRDD
QCTVPYLDTICYCDLFCNRTVSDCCPDFWGHCLGIQPPFIGVCQRNGNKFYTGQTYKENC
NLCTCGSSGHWECEKNACLIEADIIHAVNRGNYGWKAANYSQFFGMSLDEGIRYRLGTQR
PSRTVMNMNEIQMKMDPQNDHLPRYFNSSEKWPNKIHEPLDQGNCAASWAFSTAAVASDR
ISIQSMGHMTPQLSPQNLISCDTRNQGGCAGGRIDGAWWYLRRRGVVTENCYPYQPPQQA
PAEVGRCMMQSRAVGRGKRQATQRCPNTYNYHNDIYQSTPPYKLSSNEKEIMKEIMENGP
VQAIMEVHEDFFVYKNGIYKHTDVSSTKPPQYRKHGTHSVRITGWGEDKDYDGTPRKYWI
AANSWGKNWGENGFFRIARGANECEIEAFVIGVWGRISLEDMHNH
Download sequence
Identical sequences H2M9G1
8090.ENSORLP00000015144 ENSORLP00000015144 ENSORLP00000015144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]