SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015240 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015240
Domain Number 1 Region: 434-564
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 626-669
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000164
Family EGF-type module 0.0029
Further Details:      
 
Domain Number 3 Region: 727-860
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000518
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 664-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000821
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 5 Region: 336-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000486
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 6 Region: 371-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 7 Region: 294-332
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000224
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 704-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000224
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 851-909
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000575
Family VWC domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015240
Domain Number - Region: 591-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000605
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 409-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00233
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015240   Gene: ENSORLG00000012175   Transcript: ENSORLT00000015241
Sequence length 1229
Comment pep:known_by_projection chromosome:MEDAKA1:15:27273752:27297384:1 gene:ENSORLG00000012175 transcript:ENSORLT00000015241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWRRGSVAAAFLLCFLLKVSEGTGKFEIQILSMHNANGELQNGLCCDGTRNAADRKCTR
DECDTFFKVCLKEYQSRVSAAGPCSFGVGSTPVLGGNTFSFKSAVGNDITESLIVLPFSF
AWPRSYTLIVEAWDFTNETSGSGAEGKLIEKASLSGMINPSQIWQRRTHNGPIAQFEYQI
RVRCDDHYFGFGCNKFCRPRDEFFGHYTCDGNGNKTCLEGWSGPDCNTAICRQGCSTEHG
LCKEPGGCDCLYGWQGQYCDKCIPHPGCVHGTCVEPWQCLCETNWGGHLCDKDLNYCGTR
QPCLNGGTCINTGPDKYQCTCAEGYSGANCERAERACLSNPCSNGGSCSETSQGYECRCA
PGWSGPSCSMNVDDCSPNPCSHGGTCQDLVNGYKCHCPSQWTGKTCLIDANECDSKPCVN
ANSCRNLIGGYFCECLPGWMGQNCDININDCKDQCQNGGTCKDLVNGYRCLCPPGFTGEL
CERDVDECASSPCLNGGRCQDEVNGFQCLCLTGFSGNLCQLDIDYCSQNPCQNGAPCFNR
ANDYVCACPEDYEGRNCSHLKDHCRTTTCTVIDSCTVAVASNSTPGGERYISSNVCGPHG
RCRSQAGGQFTCECQEGFRGTYCHENINDCESNPCHNGGTCIDKVSVYQCICADGWEGEH
CEINIDDCSTSPCHNGGTCRDLVTDFFCECKNGWKGKTCHSRESQCDEATCNNGGTCHDE
GDTFQCRCSPGWEGTTCNIAKNSSCLPNPCENGGTCVVKGESFTCVCKEGWEGPTCTQNT
NDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCALGSTCVDEINGYR
CLCPPDRTGSHCQKLTKKHCSVNGHVAADGTKWEEDCNSCQCSNGKVVCTKMWCGPRPCT
PGGKGRGGCPLGQSCLPIRDGHCFVKPCLDVGECWHSNVKAQPPIKCHPSSSYQDSSCAN
ITFTFNKDIMPSGLTVEGVCNQLRHLNVVKNFSLEQSLFITCDPSFSASNEIHVCIVKST
EDHSLDRSPIKEITDMIIDLVSKRNGNNTIISAIVEVRVPSPSKTDLNPRVNYLVPLLSS
IFIVIWVLVLVSVLLWCMRRRRKQSNHNGTSANGSEDNTTNNVREQLNQIKNPIEKHVGL
TVAIKDYENKNSIIAKIRTNHPEGDEDDKERHLHKSRFAKQPAYTLVEKDEKAPISNPNS
TSKHPNWTNKQDNRDLETANSINRMDYIV
Download sequence
Identical sequences H2M9P8
ENSORLP00000015240 ENSORLP00000015240 8090.ENSORLP00000015240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]