SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015359 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015359
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000275
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 2 Region: 114-162
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000458
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 64-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000628
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 199-248
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015359   Gene: ENSORLG00000012278   Transcript: ENSORLT00000015360
Sequence length 248
Comment pep:novel chromosome:MEDAKA1:6:18622188:18626573:-1 gene:ENSORLG00000012278 transcript:ENSORLT00000015360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VENLMPSSCVVTEWGEWDPCSVTCGLGMRRRERMVKMPPSDGSMCKAEIAEVDKCMVPEC
HADTCVPTPWSEWSKCSATCGRGIRTRQRMRKTNQADCREETEQKECRLPECSIDCMVSE
WSEWSECNKSCGKGHTIRTRMVKLEPQFGGRACPETIQRKKCKLRKCPGKRKETRGVSAR
HLQTHGQHHLSINSKESPGCRMQPWSSWTTCTKPCGGGIQERLMVARKRAKGSCKDQREI
HACNVHPC
Download sequence
Identical sequences H2MA12
ENSORLP00000015359 ENSORLP00000015359 8090.ENSORLP00000015359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]