SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015407 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015407
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.0000144
Family GIY-YIG endonuclease 0.015
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000015407
Domain Number - Region: 72-120
Classification Level Classification E-value
Superfamily RING/U-box 0.0883
Family RING finger domain, C3HC4 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015407   Gene: ENSORLG00000012306   Transcript: ENSORLT00000015408
Sequence length 153
Comment pep:known_by_projection chromosome:MEDAKA1:18:29649264:29651855:-1 gene:ENSORLG00000012306 transcript:ENSORLT00000015408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFGVYMLYCRNPRFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMVLIIHGF
PSDIAALRVSEKVSCLHASCGMSSHLICLGRRFLQSEPSQLLPVEGECPSCRRSLLWGSL
IRHQLGCLGDLEEVTEPSSQVSQQHGWMPLWTT
Download sequence
Identical sequences H2MA58
ENSORLP00000015407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]