SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016059 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016059
Domain Number 1 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-35
Family Spectrin repeat 0.0000491
Further Details:      
 
Domain Number 2 Region: 203-358
Classification Level Classification E-value
Superfamily Spectrin repeat 7.08e-35
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 3 Region: 1614-1771
Classification Level Classification E-value
Superfamily Spectrin repeat 2.47e-34
Family Spectrin repeat 0.00000227
Further Details:      
 
Domain Number 4 Region: 102-251
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-34
Family Spectrin repeat 0.00047
Further Details:      
 
Domain Number 5 Region: 749-878
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-34
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 6 Region: 1292-1435
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-34
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 7 Region: 1722-1867
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-33
Family Spectrin repeat 0.00000365
Further Details:      
 
Domain Number 8 Region: 1828-1984
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-33
Family Spectrin repeat 0.00000309
Further Details:      
 
Domain Number 9 Region: 1400-1541
Classification Level Classification E-value
Superfamily Spectrin repeat 6.84e-33
Family Spectrin repeat 0.0000364
Further Details:      
 
Domain Number 10 Region: 838-961
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-32
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 11 Region: 422-571
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-31
Family Spectrin repeat 0.00015
Further Details:      
 
Domain Number 12 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-30
Family Spectrin repeat 0.00000945
Further Details:      
 
Domain Number 13 Region: 680-783
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-28
Family Spectrin repeat 0.0000842
Further Details:      
 
Domain Number 14 Region: 1934-2089
Classification Level Classification E-value
Superfamily Spectrin repeat 7.59e-28
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 15 Region: 2096-2209
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 16 Region: 2319-2455
Classification Level Classification E-value
Superfamily EF-hand 1.18e-22
Family Calmodulin-like 0.0051
Further Details:      
 
Domain Number 17 Region: 2211-2326
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 18 Region: 970-1033
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 19 Region: 1060-1179
Classification Level Classification E-value
Superfamily Spectrin repeat 6.88e-19
Family Spectrin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000016059
Domain Number - Region: 364-425
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00273
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number - Region: 1213-1241
Classification Level Classification E-value
Superfamily Spectrin repeat 0.072
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016059   Gene: ENSORLG00000012823   Transcript: ENSORLT00000016060
Sequence length 2482
Comment pep:known_by_projection chromosome:MEDAKA1:12:23896120:23920731:-1 gene:ENSORLG00000012823 transcript:ENSORLT00000016060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTAGVKVLETAEDIQERRQQVLDRYRRFKELSIMRRQKLEDSYRFQFFRRDADELEKWI
QEKLQIASDENYKDPSNLQGKLQKHQAFEAEVQANARAIVKLDDTGNLMITEGHFASETI
RSRLEELHRLWDLLLQKTQEKGLRLLQAQKLVQYLRECEDALDWISDKEAITTSEELGQD
LEHVELLQKKFEEFQTDLAAHEERVNEVNQLAAKLIQEEHPEAELIVRKQEEVNSAWQRL
KGLAQQRQAKLFGSAEVQRFNRDVDETISWIREKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALNQKVDTLGVEVERLQQTHPQNASQIHLKKDELITNWEQIRTLAAERRTRLNDS
YQLQRFLADFRDLISWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFRGT
DESGKALLSAGHYASEEVKEKLGVLTGEKESLLELWEVRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
KEDVATRRDALLSRRNALHERAQSRRAALEDSFHLQQFCRDSDELKSWINEKMKTATDES
YKDPSNLQGKVQKHQAFEAELSANQSRIDALQKSGQELLDRKHYAAAEVAARMEEVSSQW
KKLLEATEFKGIKLREANQQQQFNRNVEDIELWLYEVEGQLASDDFGKDLTSVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQEAGHFDSDNIRKKQEALVVRYEGLREPMAARKQKL
SDSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEITGHEPRI
KAVTQKGEAMVEEGHFAGEDVKTRLAELHGRWDTLKAKSSQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALKEQAQACRNKQ
QQVAPTDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVP
AAYVKKLDPTQSSSRENLLDEHGSIAVRQEQIETQLVTKEACSVSVRMKQVEELYGTLLE
LGEKRKDMLEKSCKKFMLFREANELQQWIHEKESALTNEEVGSDLEQVEVLQKKFDDFQK
DLKANESRLRDINKVASELESEGLMAEEAPMVQAQQQELLGSAPGKDESDSKTASPWKTV
RLGVQTTANFNSIKELNNRWRSLQQLAEDRSNLLGSAHEVQRFHRDADETKEWIEEKNQA
LNTDNYGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPEAKDDIQEKCT
ELNTAWSSLVGRADQRKEKLSNSHDLQRFLSDFRDLMSWINGIRGLVSSEELAKDVTGAE
ALLERHQEHRTEIDARAGTFQAFEQFGQHLLARGHYASPEIQQKLEALDQERADLEKAWV
QRRMMLDQCLELQLFNRDCEQAENWMAAREAFLASDDKGDSLDSVEALIKKHEDFDKAIN
VQEEKIAALQSFADQLIGAGHYAKPDITNRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQ
FSRDVDEIEAWISEKLQTATDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVI
DTGNALIQRGGCAGSEDAVKARLNALDEQWQFLVNKSAEKSQKLKEANKQQNFNTGIKDF
DFWLSEVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNGQADSLMASNAF
DTTQVKDKRDAVNGRFTKIKSMAAARRAKLNESHRLHQFFRDLDDEESWIKEKKLLVGSE
DYGRDLTGVQNLRKKHKRLEAELGAHEPAIQSVLDTGKKLSDDNTIGQEEIQQRLAQFVD
HWKELNDLSGARGRRLEESLEYQQFVANVEEEEAWINEKLNLVGSEDYGDTLAAVQGLLK
KHEAFETDFTVHRDRVSDVCANGEELIKKNNHHVDNINAKMAALRGKVSELDRAAAQRKA
KLDENSAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQ
EGITNITALKDQLLTAKHVQSKAIEARHAALIKRWNQLLSNSAARKKKLLEAQEHFRKVE
DLFLTFAKKASAFNSWFENAEEDLTDPVRCNSLEEIRALREAHEAFRSSLSSAQADFNQL
AELDQQIKSYQVVSNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEF
AQHANAFHQWLQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGA
AMEEALILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSM
MFKHFDKEKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGNVSLQE
YMAFMISRETENVKSSEEIESAFRALSAENKPYVTKEELYQNLTREQADYCLSHMKPYLD
SKGRELPSAFDFVEFTRSLFVN
Download sequence
Identical sequences H2MBY2
ENSORLP00000016059 8090.ENSORLP00000016059 ENSORLP00000016059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]