SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016216 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016216
Domain Number 1 Region: 936-1046
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000259
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 803-933
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000361
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 752-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000075
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 1028-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 586-627
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000171
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 6 Region: 663-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000016216
Domain Number - Region: 122-170
Classification Level Classification E-value
Superfamily FnI-like domain 0.00764
Family Fibronectin type I module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016216   Gene: ENSORLG00000012935   Transcript: ENSORLT00000016217
Sequence length 1220
Comment pep:known_by_projection chromosome:MEDAKA1:5:25573663:25599570:1 gene:ENSORLG00000012935 transcript:ENSORLT00000016217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEVAFLRGLWFSLCLSICLCQQDCTGVDCPLLDNCIDAILDSGSCCASCLQKGCTCEGYQ
YYDCVSAGFENGSVPEGDSYFVDYGSTECSCPLGGGRIICHFMSCPEVPPNCIEFSEPVD
GCRQCQQLGCFQGDHKYEANHSFQVGPCWICHCPSEGGELMCYREPCDAQNTTDGNSSRH
DAIPDSDEQETPNSPTDTTAAWELSQGSAGAQSVSLGDLEPHTEAERALNIHPQTIDLNV
ADSSTTEGSSLEINGEHLTRSTETLANHEREHMKTFSKTTQKTQHVPFLQSTTQSPNESY
GLDDKTRMNEDEEERGEGMEESQSVSEFDVQDLNETVKPFQKDKTHEDLGSSGLNRNGNG
NQSQPNNSTSMSLVLQQTPTVSFITTPTQAPQGKVQERLPVERWHDVAGTEELAPEAGNP
AFSAADYLDQVCSAITELQWQINKMHSQNDPFAAVNSHLSRECSIYSDNDKDNCLHDAGV
SDMKRGRTCSGPLNATCSFNSHLSLYTVCMTVISDTRTSAAQPTGSLCVATTLSEPSLSE
KSFVDQSLTLPPPFWFIPVSERKFPKEAFSITTSDEVVNMVEVQEEEDECPLHHRQQCQH
KCTIAWGSYHCSCFQGFILQQDGHSCSPGIPSTSVSPEESRVSTRHPPITIGTVETPTQS
ALIDPCAGNGLCSQRCSTVGGRVLCSCFPGFFLMKDGHTCKGEAQILYCSNTMSCPRMCA
KKKGTDEFMCTNEYTCHLVWNLGLEQACVCSADVDECLTHKCLPHQRCVNTEGSFTCRPQ
ITCPPGYHLKSSGCQDVDECAMRKDRCGKDFLCENTPGSFKCTPKQKCLSGFTQDAHGNC
VDINECSSLAQPCSSSFACVNTVGSFSCQQKVLVCNRGYHTSPDGASCVDVDECQMGSHA
CGVGQICHNLPGSYRCDCQTGYQFDALRKVCTARTDVNECWSYPGRLCAQTCENTVGSYL
CTCTAGFILASDQKNCEDINECDQKPCSQECVNMHGSYQCYCRQGYYLHEDGRTCEDIDE
CSQSIGKLCAFQCVNVVGSYLCACPPHGYVMSANGHTCTDVDECKVGSHNCSSEKTCFNL
QGGFRCLSFDCPHNYKRVSSTYCERINCAPNSFDCQKSPLRITYYTLSFQSNILTPAQIF
RMGPSPVYAGDHVIISITSGNEENYFSTRKLNSFTGAVYIQRKVREPKDFLIEVEMKLLR
RGTVTSFLARLYVFFTPSSM
Download sequence
Identical sequences H2MCD1
ENSORLP00000016216 ENSORLP00000016216 8090.ENSORLP00000016216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]