SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016430 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016430
Domain Number 1 Region: 488-543
Classification Level Classification E-value
Superfamily BPTI-like 1.84e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 2 Region: 23-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000051
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 256-309
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000706
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 186-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 
Domain Number 5 Region: 313-368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016430   Gene: ENSORLG00000013108   Transcript: ENSORLT00000016431
Sequence length 572
Comment pep:known_by_projection chromosome:MEDAKA1:24:6789304:6795585:-1 gene:ENSORLG00000013108 transcript:ENSORLT00000016431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNILQVLGLLHLLTIPALTLNTPVYDYWGEFGAFGPCSRTCGTGVAMRTRKCITSRTDGG
HNCVGSSKSYRTCSTQPCPVGLKDFREVQCSEFDTVDYHGNRLSWVPHYEASNPCEVNCV
PSGQNVFYRTQHRLQVTDGTPCNEGHTDICVEGVCRALTHEEFMGLDNDTETLHFTLPSV
PHLRETHPCTYRTGLYSECSASCNGGLQYRSVECVIEDPVHPRVVDESYCIIQHLHKPLS
QKSCNMHSCGEHRAEYSVSSFSVCSVTCGEGQQTREVVCVGPRGERLPDHACSGLVPPAS
VQACRRPACYTQITWHVTEFGLCSRSCGGGVRERQVSCFDTDLHPYSEDQCGLESKPNSV
ESCNTQPCHEAQSVPSVQDPGTEEGTTRRFVPHVPEESPTPSPDTNNADDLEPAVTDPDC
AQSVHGCCPDGYSTATGPENDGCPTEDCSFSRFGCCKDGVTAAEGDGQLGCPEHQTGKQE
HPPVPVDHASACSLPRDEGPCEKWVARFAYDAAVGKCKEFWYGGCHGNANNFASEHDCQK
QCGASRTVPVPVRRRWIYRRGFLRSVRVRPNH
Download sequence
Identical sequences H2MCZ1
8090.ENSORLP00000016430 ENSORLP00000016430 ENSORLP00000016430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]