SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016471 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016471
Domain Number 1 Region: 252-516
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-80
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 138-244
Classification Level Classification E-value
Superfamily Kringle-like 1.69e-29
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 3 Region: 38-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000483
Family EGF-type module 0.007
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000016471
Domain Number - Region: 80-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00262
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016471   Gene: ENSORLG00000013140   Transcript: ENSORLT00000016472
Sequence length 518
Comment pep:known_by_projection chromosome:MEDAKA1:15:28598030:28600994:1 gene:ENSORLG00000013140 transcript:ENSORLT00000016472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WQPRQTWQPLQTWNEEVNDSDVFFVAENTGDDEEDDDQGKCNPNPCLNEGVCKEKGKRNY
KCDCPKPFKGRRCQKGPKICRMGLCGHGECVLTSASPFYECKCKEPFQPPNCRRQVSVCE
PNPCRNGGKCIMDGNNFDCVCPEGFSGRFCRVGPNDCYLDDGESYRGNVSETDDGDDCLH
WNSHFILAHGVNPFKSFEDKDGLGPHNFCRNPDGEPKPWCFFRRGRRLLWDYCDVTPCPQ
PTRPSAGPASPTEAAASQFLTCGVPQPKKAITRIFGGLKVSPGAIPWQVSLQQKPKNSNL
PYRHVCGGVLIKSCWVLTAGHCIDKSKDMQVLMGSLSLDKTDPSAQTLPVENAIVHQRYR
ETSGAVYNDIALLRLRGTRGLCANETQFVKTACLPDAQLPDGMECTISGWGATEESQYGS
SHLLEANVLLINQGKCSEPAIYGSKLDSTMFCAGHLQGGVDSCQGDSGGPLTCKNNNSSV
IYGLVSWGDQCGKQNSPGVYTRVTHYLDWIKSTIQSNP
Download sequence
Identical sequences H2MD32
8090.ENSORLP00000016471 ENSORLP00000016471 ENSORLP00000016471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]