SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016485 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016485
Domain Number 1 Region: 4-167
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-50
Family DBL homology domain (DH-domain) 0.0000473
Further Details:      
 
Domain Number 2 Region: 152-295
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-33
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016485   Gene: ENSORLG00000013150   Transcript: ENSORLT00000016486
Sequence length 474
Comment pep:known_by_projection chromosome:MEDAKA1:24:6846171:6856599:1 gene:ENSORLG00000013150 transcript:ENSORLT00000016486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLALSSQDKSSLFGNIRDIYHFNRDLLHHLEKCNSDPVAIAECFVCKSEEFHIYTQYCTN
YPRSVAVLTECMRNKALAKFFRERQESLRHALPLGSYLLKPVQRILKYHLLLHEIANHME
KDTETHEVVQEAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLIGYGELVLE
GTFRLQRAKNERTLFLFDKLLLITKKREETYTYKAHILCCNLMLVEVIPKEPLSFSVFHY
KNPKLQHTVQAKSQQDKRMWILHLKRLILENHPAKIPAKAKQAILEMDAIHHPGFHYSPD
GDKKDSPQTKEGPTPRRGRRKEPLSKLLKNAKHNAVNNDTEKVSHNPPKILSITGVQSFT
AVLWQFRKSQGIFVTESDHSVKNIWADHRARRAMFPTRQRTMQPDDEDEDIYQMFVPTEQ
SAPEPEPPAERSETSSSPRTARPCSWHVEQVPTVQVDPPPDSSRVLRRASSVGE
Download sequence
Identical sequences H2MD46
ENSORLP00000016485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]