SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016738 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000016738
Domain Number - Region: 4-102
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00376
Family Recombinase DNA-binding domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016738   Gene: ENSORLG00000013353   Transcript: ENSORLT00000016739
Sequence length 300
Comment pep:novel chromosome:MEDAKA1:19:20029605:20031755:1 gene:ENSORLG00000013353 transcript:ENSORLT00000016739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKSKELSKDLRNLIVAKHTEGIGYRRMTFGAIIRKWKEHGITINLPRPGVPHKISDRGV
RTKLNESTVGPRDDTGELQKDLESAGTVVSKKTISNALNRHGLHARTPRKTPFLKKKHVE
ARLEFATHLDKPMTCWEKILWSDETKIELFGCHKTQHVWRKNGSAHHPQNTIPTVKFGGG
SIMAWGCFSACGTGRLHIIEGIMTGEKYPDILDQNLLSSARLLKMKRGWIFQQDYHPKHT
AKVTLNWLKKKKIKLLEWPSQSPDLNPIENLWKELKIRVHRRDPRNLEDLKAVCVDEWAK
Download sequence
Identical sequences H2MDT7
ENSORLP00000016738 8090.ENSORLP00000016738 ENSORLP00000016738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]