SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016865 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016865
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.97e-45
Family Reprolysin-like 0.0028
Further Details:      
 
Domain Number 2 Region: 294-350
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.19e-16
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 3 Region: 619-677
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 4 Region: 681-738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000262
Family TSP-1 type 1 repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016865   Gene: ENSORLG00000013444   Transcript: ENSORLT00000016866
Sequence length 738
Comment pep:known_by_projection chromosome:MEDAKA1:9:19453452:19467301:1 gene:ENSORLG00000013444 transcript:ENSORLT00000016866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLELLVVVGPDVQQFHKQDTERYILTNLNIASELLRDITLGANMRVHLVRMIILSEPEPE
ILMSNNITSSLKSVCDWGRRINPSNDTDPLHADLLLYITRYDGSMNNQVRGVAQLGGACS
SEWSCVITEDTGFDLGITIAHELGHSFGIDHDGVGNTCSRSGFMMASDGGYNSVDLTWSA
CSRQQFLTFFSDGKAECVKDVPAMEGSLQDWKPGLYYGIDDQCRIAFGSSARACSFTNPD
LPACRVLSCHVNPDDDSSCKRLLVPLLDGTECALNQWCLKGRCVSPGDLGSSAVVHGSWS
SWSDFSSCSRTCGGGVTLRTRQCNNPRPAFGGADCKGPNIQAELCNQQPCVRTQLDFMAE
QCSQTDMLPLYLLPNTASFYTWIPALGFVKGDEQCRYMCQSNGENFIVSRGVQFIDGTRC
EFDNPSSYGTTAACVQGKCMLFGCDGVLHSGKVHDVCGVCGGDGSTCSLISGFYTGGQAK
EYSTFLTLPVNATQVHIVNRAPLFTHTATAVMIGDQYIVSGKGSMALNITHPSLLENHLK
YLLHLTPDLLPEMEEVLVPGPLQREIKVQIYRKYGKEYGERTNPNVSYQFYEPNKNICSM
MDLNPSELQRSSRLSQDVSRWMAGKFGTCSASCGGGVRVRPVRCVQKQGSDVVKVSDSEC
SADNAPSTTEKCSLQNCPARWRVSEAANCSAVCGPGQAKRVVSCVRVDHQTKLGVLDSNC
EASTKPEPQAEICGTQPC
Download sequence
Identical sequences H2ME62
ENSORLP00000016865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]