SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017105 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017105
Domain Number 1 Region: 214-280
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000294
Family Pan module (APPLE domain) 0.013
Further Details:      
 
Domain Number 2 Region: 288-341
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0000173
Family Pan module (APPLE domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017105
Domain Number - Region: 29-65
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000137
Family Pan module (APPLE domain) 0.081
Further Details:      
 
Domain Number - Region: 119-156
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000392
Family Pan module (APPLE domain) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017105   Gene: ENSORLG00000013639   Transcript: ENSORLT00000017106
Sequence length 378
Comment pep:known chromosome:MEDAKA1:11:26216921:26223166:-1 gene:ENSORLG00000013639 transcript:ENSORLT00000017106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGGLLCVSLLCLSSFAITEGCNRQLLQNVDFPGSDIKTFYSPDVEHCQLLCTQQPSCHF
FTFHQANWTKDDRTFKCFLKSASSGQPNSQTPLQGVTSGFSLKSCNPSPQPCLSQVYENV
DFVGADYTSFFTADHEDCQKACTQDPSCQFFTYVKQDPKQKNVRYKCFLKYSWNIPRTSS
VEKKVGVVSGFSQTPTGNPSQTACQNKFLPNTDIPGSDFQTLKAASAEHCQALCSAHPQC
TYFTFGSLDFKCHLKNNKHHLETKAKEGATSGMPARFCQFTNWLRTAYEGIDFPGSEIRF
ELKDNADQCQRLCSGDPTCQFYTYVKDNSPESAARRRCYLKGVITMPAPPKVVKVTNVVS
GFSTRNCAATGPNRVSCV
Download sequence
Identical sequences H2MEU2
XP_004074442.1.28442 ENSORLP00000017105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]