SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017112 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017112
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.01e-41
Family Frizzled cysteine-rich domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017112   Gene: ENSORLG00000013641   Transcript: ENSORLT00000017113
Sequence length 516
Comment pep:known_by_projection chromosome:MEDAKA1:9:19890847:19893052:1 gene:ENSORLG00000013641 transcript:ENSORLT00000017113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRCQHITIPLCKDIGYNMTRMPNLMGHDDQLEAAIKLQEFASLIQCGCHSHLKFFLCSLY
APMCTEQVSNPIPACRVMCEQVKVKCSPILEKFQFPWPDSLDCSRLPTKNDPNNLCMEAP
NNSSDEPPKVPHTQPPDFRPQQPLSGQDLHPKDIGEKQTCSNPGKFHFVEKSESCAPKCY
PKVDVFWSQGDKQFSLVWMAIWSILCFVSSAFTVLTFLIDPQRFKYPERPIIFLSMSYCV
YSVGYLIRLFVGADGIACDRDNGVQYIIQEGLESTGCTIVFLILYYFGMASSLWWVILTL
TWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIMILVMRKVAGDELTGVCYVGSMDVK
ALTGFVLIPLSCYLIIGTSFLLSGFVALFHIRKVMKTEGENTDKLEKLMVRIGVFSVLYT
VPATCVIACYFYERLNMDYWRILAWKQKCVDGSRPESDECVMKASIPAIEIFMVKIFMLL
VVGITSGMWIWTSKTLQSWQNVFSKKKNKNTLVLNV
Download sequence
Identical sequences H2MEU9
ENSORLP00000017112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]