SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017172 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017172
Domain Number 1 Region: 465-661
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.14e-69
Family Hemopexin-like domain 0.0000000815
Further Details:      
 
Domain Number 2 Region: 95-218,391-446
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-36
Family Matrix metalloproteases, catalytic domain 0.0000028
Further Details:      
 
Domain Number 3 Region: 279-334
Classification Level Classification E-value
Superfamily Kringle-like 9.71e-21
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 4 Region: 338-393
Classification Level Classification E-value
Superfamily Kringle-like 2.23e-20
Family Fibronectin type II module 0.00012
Further Details:      
 
Domain Number 5 Region: 222-276
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-19
Family Fibronectin type II module 0.00015
Further Details:      
 
Domain Number 6 Region: 41-106
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000053
Family MMP N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017172   Gene: ENSORLG00000013688   Transcript: ENSORLT00000017173
Sequence length 661
Comment pep:known chromosome:MEDAKA1:3:27995158:28007470:-1 gene:ENSORLG00000013688 transcript:ENSORLT00000017173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPIVKSCRGIVLKVFVLLFIVFQLSNARPSPIIRFPGDDTPKTDKEVALDYLNKFYGC
PQDSCNLMVLKDTLKTMQKFFTLPEKQMLQTVSPIMKKPRCGVPDVANYNFFHNKPKKWQ
KKDITYRILGYSPDLDEEVINDAFYRAFKVWSDVTPLSFTRIMDGEADIMINFGRNEHGD
GYPFDGKDGLLAHAFAPGGGIGGDSHFDDDEQWTLGEGQVVKAKFGNADGEFCKFPFLFM
GTEYKSCTAQGRDDGFLWCSTTYNFDEDGKYGFCPHELLFTLGGNGDGAPCKFPFTFQGK
QYDSCTTEGRDDGYRWCATTEDYDRDTSYGFCPETAMSTVGGNGEGSPCVFPFTFLGDTY
ESCTTSGRSDGKMWCATTKSYDDDRKWGFCPDQGYSLFLVAAHEFGHALGLEHSQDPGAL
MAPVYTFTKDFRLPQDDIQGIQELYGESQCVPTDKPLPPTQGPVTPMDICKESIVFDAVA
QIRGETFFFKDRFLFRSVNFRSKPKGPLLVATYWPDLPAKIDAAYENPAEEKTVFFAGNQ
FWVYRADELQSGYPRRLSNLDLPDDVQRIDAAFNFRRNRKTYLFSGDKFWRYDEDRKTMD
PGFPKLIADSWNGIPDDLDSAFSLNGIDYSYFFKGNHYFKLEDNTLKIVKLGEIKTDWLG
C
Download sequence
Identical sequences H2MF06
ENSORLP00000017172 8090.ENSORLP00000017172 ENSORLP00000017172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]