SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017573 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017573
Domain Number 1 Region: 114-381
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.93e-82
Family Eukaryotic proteases 0.0000312
Further Details:      
 
Domain Number 2 Region: 17-116
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-26
Family Kringle modules 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017573   Gene: ENSORLG00000014015   Transcript: ENSORLT00000017574
Sequence length 394
Comment pep:known chromosome:MEDAKA1:19:20836985:20843082:1 gene:ENSORLG00000014015 transcript:ENSORLT00000017574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLNGGSSFPSLITGEHLFCVCPEGFAGIHCETEVTNDCYEGVGLYYRGQVSETASGRACA
EWDPETRRRFLSWDLHSGRHNYCRNLHFRRRPWCYVGKNHQLQWEYCEIPRCGFQPAEES
TCGQRTRGRQMKIVGGTVSSVESHPWMAAIFWRSKSEKKVFRCGGSLISACWVLTAAHCF
LDGSRSRARHFSVTLGKSALNESNPDTEQMFKVDKIFTHEGFDNSDGNYNNDIALLKLKP
KRGRCAEESAAVKPVCLPPPAQTLHPGFPCQVSGFGKERHELWYNSQYLREAQVNILADD
VCRREDYYGNMITDNMICAASPNWSQDACKGDSGGPLVCAVAERFFLFGVVSWGDGCAEE
FRPGVYTKVTNYNKWIEEKTGLSAITAGSEFPPK
Download sequence
Identical sequences H2MG43
ENSORLP00000017573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]