SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017867 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017867
Domain Number 1 Region: 891-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000034
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 2 Region: 831-888
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000366
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 3 Region: 713-769
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000484
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 655-712
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000772
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 5 Region: 58-87
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 595-652
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 773-826
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000017867
Domain Number - Region: 296-348
Classification Level Classification E-value
Superfamily MFPT repeat-like 0.0645
Family MFPT repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017867   Gene: ENSORLG00000014245   Transcript: ENSORLT00000017868
Sequence length 995
Comment pep:known_by_projection chromosome:MEDAKA1:3:30227877:30263769:-1 gene:ENSORLG00000014245 transcript:ENSORLT00000017868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVSIVSAFLCRVCVLLLLLHCPDQLDSQHTTDHRKVSFRQRGQKEVPQRAENGDAQSSWG
SWGPWSSCSRTCGNGVQGQTRACLPVYMQPSRGAGVQLQHAGRIISALSPGASPHRHGGD
LRFLRFGGAKYQQSSQNPAYWRISKSWECEGLQASGRESKQSRVTSILPGKYGYGRGPYA
APLQTDAGRRSEAPHLHKQRRSAAATSHHPIARGRSSFRSNSPNNLHGFSRPTHSNAQHL
RHNQVWAPLYQPTSSNMGRVQPEVHPGSRQQHQERLYNPLPTSYCSGEHAHYRICHSNAC
PPSSGHIRVLQCSSFNKQPFMGRLYEWEPFNEVQEEQLCELHCRAVGFRFYVRHSEKVID
GTPCGQSDASLCVDGRCTNLGCDGYLGSGKVIDKCNVCGGDNSTCRLVSELFKHSFSKIG
YHKIAEIPEGATKINVTEMVKSRNYLALRSRSGRSIINGNWAIDRPGRYEGGGTIFTYRR
PNEISSTAGESLLADGPTNEILDIYIIFQQQNPGVHYEYILPSQKITGPQKPNHRPEGKL
CLLLRKSVRQESKAGNGQDEQEKENVNSADQGRSPPHRPDNQVPAVQPPRRGREYNWKQT
SATECSVSCGKGVRYPIFHCVNRLNHVQVSDSLCDSSSRPSSQEEACNLQPCPGFWDIGE
WSECSKTCGLGMQHRQVLCRQVYANRTLNVHTSHCRHLERPETASSCQLKICSEWQIRSE
WTSCSVPCGLGQRSREVRCVSNVGDFVSDEECNMNLRPIDMENCDMGACAKSWFYTEWGD
KCSAECGMGVKTRGVLCLTNHISSLPLEGCGSERPADSRVCNNGPCENRIEWFTGPWSQC
SAECGPGSQQRAVVCLVKSEEGISVMPPYECSSLNRPLSQQSCNLKACGAKWYHTEWSAC
SKTCEGGFRVREVRCLSDHEVQSSEGCDERLKPAARESCNPEPCMPQIDENCRDKYFNCN
MVVQARLCVYDYYKTTCCASCIRVAHKQMIHRGRS
Download sequence
Identical sequences H2MGX3
8090.ENSORLP00000017867 ENSORLP00000017867 ENSORLP00000017867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]