SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018001 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018001
Domain Number 1 Region: 6-125
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.14e-27
Family Frizzled cysteine-rich domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018001
Domain Number - Region: 572-646
Classification Level Classification E-value
Superfamily BTV NS2-like ssRNA-binding domain 0.0693
Family BTV NS2-like ssRNA-binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018001   Gene: ENSORLG00000014357   Transcript: ENSORLT00000018002
Sequence length 721
Comment pep:known_by_projection chromosome:MEDAKA1:23:14548438:14555684:1 gene:ENSORLG00000014357 transcript:ENSORLT00000018002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKKTTTCEVLKYNTCLGSPLPYSHTSLILAEDSSSQEEVFEKLTMWSGLRNAPRCWSVIQ
PLLCAIYMPKCENGQVELPSQSLCLATRRPCSIVDQERGWPTFLKCDQFPVGCSNEVQKL
KFNTSGQCEAPLVKTDIQSSWYKDVEGCGIQCDNPLFTQDEHNDMHAYIAYFGTITLLCT
FFTLATFLADWKNSNRYPAVILFYINACFFVGSIGWLAQFLDGARKEIVCKSDNTMRLGE
PSSSETLSCVTIFIIVYYSLMSGVIWFVMLTYAWHTSFKALGTTHQPLSGRTSYFHMVTW
SVPFVLTVAILAIAEVDGDSVSGICFVGYKNYKYRAGFVLAPIGMVLLVGGYFLIRGVMT
LFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVFITFGCHFYDFFNQAEWEKSFR
EYVLCEANVTIASQTNKPIPECTIKNRPSLMVEKINLFSMFGTGIAMSTWVWTKATILIW
KRTWFKILGRSDNEPKRIKKSKMIAKAFAMRKELHKDPEKELSFSMHTVSHDGPVAGINF
DINEPSNDVSSAWAQHVTKMVARRGAILPEDISVTPTGTPVPPPEERNRLWLVEAEISPD
MIKRKKKKKKKRRKEVRPAEEVADPQPYPQREFGRSSVPRLPKLPCNSSLVGNLHRQQRE
QQKMEEEVLPGSCPDFPPSHPLSYEERCPYLQCQDTMAGYGPVHSRTNLMEAELMDADSD
F
Download sequence
Identical sequences H2MHA0
8090.ENSORLP00000018001 ENSORLP00000018001 ENSORLP00000018001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]