SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018061 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018061
Domain Number 1 Region: 146-471
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.22e-78
Family Pancreatic carboxypeptidases 0.00000308
Further Details:      
 
Domain Number 2 Region: 7-126
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.45e-32
Family Frizzled cysteine-rich domain 0.00042
Further Details:      
 
Domain Number 3 Region: 471-549
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.3e-18
Family Carboxypeptidase regulatory domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018061   Gene: ENSORLG00000014408   Transcript: ENSORLT00000018062
Sequence length 613
Comment pep:known_by_projection chromosome:MEDAKA1:1:37744763:37753176:1 gene:ENSORLG00000014408 transcript:ENSORLT00000018062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVATAACTELNLGYCNDLDYSRTIFPNILGHQSRVEAESGAEYLLLSVIHGLLNGECSP
EIRLVGCSVLASPCRDDKMIKPCRRTCEALRKDCSHAFEAIEMAWPYFLDCDRFFASDQE
GCFDPLAGLKAKQELALSSLSPEEPSTIIQFTYTSNSQMYSLLKRTAAKCAHISHVYSIG
RSTEGRDLLVIEFTNNPGQHELLEPEVKMVGNMHGNEVLGRQLLIYLAQYLCSEYNLGNQ
RIQSIINSTRIHILASMNPDGYELASSEGHLLNGWTNGRSNAQNIDLNRNFPDLTSIFYR
NRRSRHYRTDHIPIPDGYWFGKVAPETYAVMKWIRSLPFVQSASLHGGELVVSYPFDFSR
HPQEERMFSPTPDEQAFKQMARTYADAHATMSNNDTDRCGASFYWNRGIINGALWYSFAG
GMSDFNYLHTNCMEITVELGCDKFPPEAELYPEWKRNKEALLSFLESVHRGIKGEVKDTD
GNGIKGATVSVRGIRKDVTTAEDGDYWRLLNPGTYIVTATAKGYSKVSKRVHLPHRMNKA
GRVDFVLEKVPVEPGIEDHLFPTVDSWERFDPYNQFERFSEGDGGVERQEKPWWWNYFSQ
SGISPPTWLLRNV
Download sequence
Identical sequences H2MHF6
ENSORLP00000018061 ENSORLP00000018061 8090.ENSORLP00000018061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]