SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018151 from Oryzias latipes 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018151
Domain Number 1 Region: 56-527
Classification Level Classification E-value
Superfamily Sema domain 3.66e-126
Family Sema domain 0.0000723
Further Details:      
 
Domain Number 2 Region: 1377-1504,1700-1889
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.54e-51
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 1062-1166
Classification Level Classification E-value
Superfamily E set domains 1.96e-16
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 4 Region: 980-1062
Classification Level Classification E-value
Superfamily E set domains 2.45e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.06
Further Details:      
 
Domain Number 5 Region: 877-961
Classification Level Classification E-value
Superfamily E set domains 0.000000000000025
Family Other IPT/TIG domains 0.009
Further Details:      
 
Domain Number 6 Region: 530-581
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000942
Family Plexin repeat 0.0014
Further Details:      
 
Domain Number 7 Region: 1169-1243
Classification Level Classification E-value
Superfamily E set domains 0.000028
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.059
Further Details:      
 
Domain Number 8 Region: 829-864
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000458
Family Plexin repeat 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000018151
Domain Number - Region: 674-705
Classification Level Classification E-value
Superfamily Plexin repeat 0.0837
Family Plexin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018151   Gene: ENSORLG00000014480   Transcript: ENSORLT00000018152
Sequence length 1919
Comment pep:known_by_projection chromosome:MEDAKA1:23:14713622:14917673:-1 gene:ENSORLG00000014480 transcript:ENSORLT00000018152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLTRIRTSFSVCCFLFSLVLPVTSQTVVQAPQAQSASSQVITAVLQEEEEEYASFHAE
NPEWTFNHLAVDYRNGNVYLGAVNRIYKLSPGLDVQVFHVTGPEEDNRKCYPPRIVQPCN
EPLTLTNNVNKMLLMDYKENRLLACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGVNE
SGSVFGVIVSYGNASPDMLFVATAVDGKPEYFPTISSRKLARNSEEDGMFAYVFHDEFVA
SMIKIPSDTFTVIPDFDIYYIYGFASGNFVYFLTLQPEMGGGPTTGSSSAGREQVYTSKI
VRLCKADTAFNSYVEVPIGCISGNVEYRLLEAAYLSKAGAILARSLDVTPDDDVLFAVFS
KGQKRRPRQASQDSALCVFSLRKINEKIKERLQSCYKGEGTLDLAWLKVKDIPCSSALLT
IDDDFCGLDMNAPLGVSEMVRGKPVFSDATDKMTSVIAYVYKNHSLVFVGTKSGKIKKIR
VDGSSRAHRYETVQAVESGPIQRDMAFSSDHHYLYVMSHTQLSRVPVEACGQYSTCSECL
GSGDPHCGWCVLHNMCARKEKCERSSEPRRFASDIKQCVRLSVHPNNISVSQFSVTLVLE
AHNVPELSAGVNCTFQNLAEMNGLVEGNRIKCYSPAEREMPRIIVDKGDHQIVQLFLKSK
ETGLAFANTSFVFYNCSVHKSCVSCVSSPYQCHWCKYRHVCTHDPSTCSFQEGRVKNPEG
CPQLLPADRILVPVNVVKPITLRAKNLPQPQSGQKGYECVLTIQGNEHRVPALRYNSSSV
QCQNTSYFYDGMEMSSLPVELTVIWNGDFCIDNPAHNKVTVHLYKCDAQRGSCGLCLKAD
PLFGCVWCKGENRCTLKQDCPHPENQWLEPNGINSKCTHPRITQITPLRGPRDGGTLVTI
RGENLGLDFREIQGNVKVAEVNCTPIREGYIPAEQIVCEMGKAEMSQYTGNVKVCVGVGP
CRPEFTAKSLKYYYFVIPRITTLKPNRGPISGGTIVNITGSHFDAGSSVSVVFKDQPCTY
LKRGGQWLTCRTHASLHGYGNVSVSVSIDKAKLQKDLQFEYVEDPSITKIEPEWSIFSGH
TPVTVTGTNLDIIQTPLIRAKYNGHETLNLCEVLNPTTMLCQAPELPISFARHQEVPEKP
DEFGFKLDDVQSLMALNNTNFIYYPNPEFEPLSASGVLELKPGSPIILKGRNFLPPTNSG
NGKLNYTVLIGEKPCMLTVSETQLLCESPNLTGRHKVLARVGGIEFSPGVVHITSDSPLS
STAIIGITAAGVLLIFFIVVMLIAYKRKSRESDLTLKRLQMQMDNLESRVALECKEAFAE
LQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIEEHPVLRDLEVPGYRQEQVEKGLKLF
GQLINNKIFLLCFIRTLEAQRGFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLSDLIDR
NLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPID
SITGEARYSLSEDKLIRQQIDYKTLVVNCIHPENEKSPEIQVKVLNCDTISQVKEKILDA
IYKNVPYSHRLKSSDMDLEWRQSRGQRMILQDEDITTKIEADWKRLNILCHYQVPDNAVM
ALVPKQVTAYNSVNNSTVSRTSASKYENMIKYTGSPDSLRSRTPMITPDLESGVKVWHLV
KNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKY
MFDFLDEQADKHSIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVA
QTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYSDINRMPAISDQDMNAYLAE
QSRMHMNEFNSMSSLSEIYSYVGKYTEEIVCALEQDDAARKQRLAFKLEQVVAFMSLES
Download sequence
Identical sequences H2MHN8
ENSORLP00000018151 ENSORLP00000018151 8090.ENSORLP00000018151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]